BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12a13 (264 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 21 3.4 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 19 7.8 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 19 7.8 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 20.6 bits (41), Expect = 3.4 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 7/35 (20%) Frame = +3 Query: 90 RPI--PQWVRMRTGNTIRYNAKR-----RHWRRTK 173 RP+ P V+ RT IR+ + R R+WR+ K Sbjct: 4 RPVYRPTIVKKRTKKFIRHQSDRYSKLKRNWRKPK 38 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 19.4 bits (38), Expect = 7.8 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 145 LRGVTGEGQSSSCKLVNVLNVI 210 +RG SS L N LNVI Sbjct: 18 IRGGVVRENSSGKNLTNTLNVI 39 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 19.4 bits (38), Expect = 7.8 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 117 ASLPTEEWVCFVSAFWPIC 61 ASLP ++ V AF +C Sbjct: 296 ASLPPVSYLKAVDAFMSVC 314 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,619 Number of Sequences: 438 Number of extensions: 1110 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 48 effective length of database: 125,319 effective search space used: 4887441 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.9 bits)
- SilkBase 1999-2023 -