BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12a10 (374 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32430.1 68417.m04616 pentatricopeptide (PPR) repeat-containi... 30 0.58 At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containi... 29 1.0 At5g16860.1 68418.m01975 pentatricopeptide (PPR) repeat-containi... 28 2.3 At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / po... 28 2.3 At4g30700.1 68417.m04351 pentatricopeptide (PPR) repeat-containi... 27 3.1 At3g26580.1 68416.m03318 expressed protein 27 4.1 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) n... 27 4.1 At4g20290.1 68417.m02963 expressed protein 27 5.4 At2g37380.1 68415.m04584 expressed protein 27 5.4 At4g35880.1 68417.m05095 aspartyl protease family protein contai... 26 7.1 At4g31070.1 68417.m04411 pentatricopeptide (PPR) repeat-containi... 26 7.1 At5g45800.1 68418.m05632 leucine-rich repeat transmembrane prote... 26 9.4 At4g38570.1 68417.m05460 CDP-diacylglycerol--inositol 3-phosphat... 26 9.4 At3g45230.1 68416.m04881 hydroxyproline-rich glycoprotein family... 26 9.4 At2g14570.1 68415.m01632 SWIM zinc finger family protein 26 9.4 >At4g32430.1 68417.m04616 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 763 Score = 29.9 bits (64), Expect = 0.58 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = +3 Query: 114 GLLNAV-IKRNIIVALALSGVA---GFTFKQLIGNERKRKYAEFYRTYDAEKEFEEM 272 GL+NAV I L + G+ GF + +GN YA+F DA+K FE++ Sbjct: 377 GLINAVKCNEQIKEGLKIHGLCIKTGFVSEPSVGNSFITLYAKFEALEDAKKAFEDI 433 >At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 501 Score = 29.1 bits (62), Expect = 1.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 177 GFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGL 287 GF F +GN Y +T DA K F+EM ++ + Sbjct: 143 GFDFDVYVGNNLIHLYGTCKKTSDARKVFDEMTERNV 179 >At5g16860.1 68418.m01975 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 850 Score = 27.9 bits (59), Expect = 2.3 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 153 ALALSGVAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEM 272 A ALS V GF +GN Y+ DA K F+EM Sbjct: 149 AHALSLVTGFISNVFVGNALVAMYSRCRSLSDARKVFDEM 188 >At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / potassium channel protein identical to SKOR [Arabidopsis thaliana] gi|3810676|emb|CAA11280; member of the 1 pore, 6 transmembrane (1P/6TM) Shaker K+ channel family, PMID:11500563 Length = 828 Score = 27.9 bits (59), Expect = 2.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 206 ITNELLEGKTSDARESQSNNNVTFDDGVEE 117 I N LLEGK S+ R Q +++TF +E Sbjct: 516 ILNNLLEGKESNVRIKQLESDITFHISKQE 545 >At4g30700.1 68417.m04351 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 792 Score = 27.5 bits (58), Expect = 3.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 171 VAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKK 281 V G + L+G+ + Y +F+R DA K F+ M +K Sbjct: 147 VDGCDSELLLGSNIVKMYFKFWRVEDARKVFDRMPEK 183 >At3g26580.1 68416.m03318 expressed protein Length = 350 Score = 27.1 bits (57), Expect = 4.1 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 198 IGNERKRKYAEFYRTYDAEKEFEEMRKK 281 + ERKR+ EF+ T + E++ EE++ K Sbjct: 113 VEKERKRRAKEFHDTKELERKAEELQYK 140 >At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma-associated protein A domain, PF01857 retinoblastoma-associated protein B domain Length = 1013 Score = 27.1 bits (57), Expect = 4.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 174 AGFTFKQLIGNERKRKYAEFYRTYDAEKE 260 A F L+ KR + EF+ TYDA E Sbjct: 149 ANFVHLSLLSKYYKRGFREFFLTYDANAE 177 >At4g20290.1 68417.m02963 expressed protein Length = 118 Score = 26.6 bits (56), Expect = 5.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 189 KQLIGNERKRKYAEFYRTYDAEKEFEEMRKKG 284 K+ G E+KR+ + D E+E EE R+KG Sbjct: 13 KERGGEEKKRRRSALNSEEDEEEEEEEGRRKG 44 >At2g37380.1 68415.m04584 expressed protein Length = 321 Score = 26.6 bits (56), Expect = 5.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 41 NFSKIIIRHGWRKCSIDSEQASDARS 118 +FS +I RH KCS S +S A S Sbjct: 228 SFSGVIQRHSQAKCSTSSSSSSSASS 253 >At4g35880.1 68417.m05095 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 524 Score = 26.2 bits (55), Expect = 7.1 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -1 Query: 230 FSILSLALITNELLEGKTSDARESQSNNNVTFDDGVEETSHLRLARCRYCT 78 F + ++ + L+ G+ ES+S +++TF DG + L Y T Sbjct: 60 FEYFNALVLRDWLIRGRRLSESESESESSLTFSDGNSTSRISSLGFLHYTT 110 >At4g31070.1 68417.m04411 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 613 Score = 26.2 bits (55), Expect = 7.1 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 174 AGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGLFQSC 299 AG ++ N YA+F R Y K F+EM + C Sbjct: 76 AGADCDTVVSNSLISMYAKFSRKYAVRKVFDEMLHRDTVSYC 117 >At5g45800.1 68418.m05632 leucine-rich repeat transmembrane protein kinase, putative Length = 666 Score = 25.8 bits (54), Expect = 9.4 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = -1 Query: 239 SVEFSILSLALITNELLEGKTSDARESQSNNNVTFDDGVEET--SHLRLA 96 +VEF + S +I ELL GK +S + + EE S LRLA Sbjct: 573 NVEFDVYSFGVILFELLTGKQGSDENVKSVRRLVKERRGEEALDSRLRLA 622 >At4g38570.1 68417.m05460 CDP-diacylglycerol--inositol 3-phosphatidyltransferase, putative / phosphatidylinositol synthase, putative similar to phosphatidylinositol synthase (PIS1) - Arabidopsis thaliana, PID:e1313354 [gi:3367632] Length = 225 Score = 25.8 bits (54), Expect = 9.4 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Frame = +3 Query: 105 QMRGLLNAVIKRNIIVA-----LALSGVAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEE 269 Q L+N V+K + ++ LALS + G++ KQ+I + + A+ YD EK+ ++ Sbjct: 166 QTENLMNVVVKSLMQISPLSLLLALS-IFGWSIKQIINVIQMKTAADVCVLYDIEKQHKK 224 >At3g45230.1 68416.m04881 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420 Length = 175 Score = 25.8 bits (54), Expect = 9.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 147 IVALALSGVAGFTFKQLIGNERKRKY 224 I A+ + GVAGF +K+ N R+ +Y Sbjct: 142 IAAVCVVGVAGFVYKKRQENIRRSRY 167 >At2g14570.1 68415.m01632 SWIM zinc finger family protein Length = 435 Score = 25.8 bits (54), Expect = 9.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 217 ESMLNSTEPMMLKRNLRRCARRVYSNPAK 303 + +LN+ E + K R CAR +Y N K Sbjct: 275 KGLLNAIERKLPKVEYRMCARHIYGNLKK 303 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,713,898 Number of Sequences: 28952 Number of extensions: 110282 Number of successful extensions: 384 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 507810264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -