BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11p20 (679 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31A2.09c |apm4||AP-2 adaptor complex subunit Apm4 |Schizosac... 28 1.1 SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyc... 27 1.9 SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccha... 27 3.3 >SPAC31A2.09c |apm4||AP-2 adaptor complex subunit Apm4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 446 Score = 28.3 bits (60), Expect = 1.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 503 P*PTSSRTGPPQTRRGRAAHQPSSTPSSWRV 595 P PT+ P+ RG+A ++PS +W++ Sbjct: 337 PVPTNVVKANPRVNRGKAGYEPSENIINWKI 367 >SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1085 Score = 27.5 bits (58), Expect = 1.9 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 571 EHALKLESDVTNSIREVIKTCESSFNDYHLV--DYLS 675 E +L V N I ++KTC +S ND ++ DY+S Sbjct: 749 ESQKELMYGVRNDIDALVKTCTTSLNDADIILSDYIS 785 >SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccharomyces pombe|chr 2|||Manual Length = 1102 Score = 26.6 bits (56), Expect = 3.3 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 351 NPVLSHG-GLLLDRYGEPPRLREAILRC 431 +P L +G G+L DRYG EA ++C Sbjct: 437 DPKLWYGIGILYDRYGSHEHAEEAFMQC 464 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,377,641 Number of Sequences: 5004 Number of extensions: 44984 Number of successful extensions: 120 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -