BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11p15 (721 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 23 3.3 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 23 3.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.8 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 5.8 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 5.8 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 152 YSTFVC*TYYTKLLTVT 102 YS +V TYY +L T+T Sbjct: 60 YSIYVRHTYYRRLYTIT 76 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 152 YSTFVC*TYYTKLLTVT 102 YS +V TYY +L T+T Sbjct: 60 YSIYVRHTYYRRLYTIT 76 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 22 PPRVLSHFGYLLI*VSRYLKWIAGVSW 102 P + + GY + +S+YL WIA +++ Sbjct: 2487 PSKAVMDAGYDVPALSQYLDWIAVMTY 2513 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 22 PPRVLSHFGYLLI*VSRYLKWIA 90 P R + GY + +S+YL WIA Sbjct: 1989 PSRRVVDAGYDVPTLSKYLDWIA 2011 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 5.8 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = +1 Query: 22 PPRVLSH--FGYLLI*VSR---YLKWIAGVSWVTVSN 117 PP V+ FG + VS Y KW++ +SW N Sbjct: 562 PPLVIPFLLFGGFFLNVSSIPIYFKWLSFLSWFRYGN 598 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.8 bits (44), Expect = 5.8 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = +1 Query: 22 PPRVLSH--FGYLLI*VSR---YLKWIAGVSWVTVSN 117 PP V+ FG + VS Y KW++ +SW N Sbjct: 562 PPLVIPFLLFGGFFLNVSSIPIYFKWLSFLSWFRYGN 598 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,972 Number of Sequences: 336 Number of extensions: 3637 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -