BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11p15 (721 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0989 - 33343233-33344417 28 6.5 01_06_1322 - 36290275-36291693,36291837-36291954,36292485-36292516 28 6.5 >02_05_0989 - 33343233-33344417 Length = 394 Score = 28.3 bits (60), Expect = 6.5 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -2 Query: 576 LLLSDFDIVPTSSAGIQFHKQQSLACHKEG-VNSSSRCPGIEDTPFKTELL 427 L LS + P + +QF+ QQSL HKE +N SS +D + ELL Sbjct: 15 LRLSIISLAPPNCTHLQFNSQQSLD-HKESFLNRSSNDDEDDDDCVELELL 64 >01_06_1322 - 36290275-36291693,36291837-36291954,36292485-36292516 Length = 522 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 15 TLTSSCAKSFWVPVDLSLP 71 T + CA+ W+PVDL LP Sbjct: 43 TASRRCAEKMWMPVDLRLP 61 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,080,906 Number of Sequences: 37544 Number of extensions: 357852 Number of successful extensions: 731 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -