BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11p15 (721 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80024-9|AAK18886.1| 300|Caenorhabditis elegans Serpentine rece... 33 0.27 Z48334-6|CAA88313.1| 655|Caenorhabditis elegans Hypothetical pr... 28 5.8 AF314467-1|AAG41979.1| 655|Caenorhabditis elegans APC6 protein. 28 5.8 >U80024-9|AAK18886.1| 300|Caenorhabditis elegans Serpentine receptor, class bc (class b-like) protein 10 protein. Length = 300 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 436 SLERCVFDTWAPRRTINALLMACQALLFVKL 528 ++++C FD WA R + AL C LL +KL Sbjct: 176 AVDKCFFDHWADRSIMYALNFLCSGLLSIKL 206 >Z48334-6|CAA88313.1| 655|Caenorhabditis elegans Hypothetical protein F10B5.6 protein. Length = 655 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 107 QLVTLYNMSNKQMWNKFRPKKNQVLTFH 190 +L+ YN+ MW K+R +N+ L H Sbjct: 241 RLMAKYNLVEPAMWEKYRKVRNEQLKLH 268 >AF314467-1|AAG41979.1| 655|Caenorhabditis elegans APC6 protein. Length = 655 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 107 QLVTLYNMSNKQMWNKFRPKKNQVLTFH 190 +L+ YN+ MW K+R +N+ L H Sbjct: 241 RLMAKYNLVEPAMWEKYRKVRNEQLKLH 268 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,071,849 Number of Sequences: 27780 Number of extensions: 330014 Number of successful extensions: 725 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 725 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1687292480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -