BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11p14 (743 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 23 2.3 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.0 AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding prote... 23 4.0 AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding prote... 23 4.0 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 23.4 bits (48), Expect = 2.3 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +2 Query: 317 ICGIQNARAKIIGLQED 367 +CG+QN RA+ + + +D Sbjct: 14 MCGVQNLRARSVNIFQD 30 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 3.0 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = +3 Query: 54 TIDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISEL 227 T+D S N I +L + ++ + +NNN I + N NL V + N I + Sbjct: 599 TLDASHNRITELSPLSVPDSVELLFINNNYINLVRPNTFTDKVNLTRVDMYANMIETM 656 Score = 22.6 bits (46), Expect = 4.0 Identities = 11/49 (22%), Positives = 25/49 (51%) Frame = +3 Query: 90 DGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELGDL 236 D F L+ L + + + + + N + NL+++ LT N + ++ D+ Sbjct: 141 DSFLGLRELHTLEIVESNVQALPVNSLCSLDNLQTLNLTENRLRDINDI 189 >AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding protein ASP6 protein. Length = 146 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 165 LEHYIPNLESVILT 206 LE YIP +ESV+ T Sbjct: 101 LEEYIPRVESVVET 114 >AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding protein protein. Length = 120 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 165 LEHYIPNLESVILT 206 LE YIP +ESV+ T Sbjct: 75 LEEYIPRVESVVET 88 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,305 Number of Sequences: 438 Number of extensions: 4705 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -