BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11p14 (743 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, p... 194 5e-50 At3g50690.1 68416.m05546 leucine-rich repeat family protein 47 1e-05 At4g03260.1 68417.m00445 leucine-rich repeat family protein cont... 40 0.001 At1g04210.1 68414.m00411 leucine-rich repeat family protein / pr... 40 0.002 At4g34280.1 68417.m04873 transducin family protein / WD-40 repea... 39 0.004 At1g71440.1 68414.m08253 tubulin folding cofactor E / Pfifferlin... 39 0.004 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 38 0.005 At1g47890.1 68414.m05333 disease resistance family protein conta... 38 0.005 At1g78230.1 68414.m09116 leucine-rich repeat family protein 38 0.007 At5g22320.1 68418.m02604 leucine-rich repeat family protein cont... 37 0.016 At1g48540.2 68414.m05428 leucine-rich repeat family protein 36 0.021 At1g48540.1 68414.m05427 leucine-rich repeat family protein 36 0.021 At1g72180.1 68414.m08346 leucine-rich repeat transmembrane prote... 34 0.087 At2g33080.1 68415.m04056 leucine-rich repeat family protein cont... 33 0.15 At3g23010.1 68416.m02901 disease resistance family protein / LRR... 31 1.1 At4g24490.1 68417.m03510 geranylgeranyl transferase alpha subuni... 30 1.4 At1g17440.2 68414.m02133 transcription initiation factor IID (TF... 30 1.4 At1g17440.1 68414.m02132 transcription initiation factor IID (TF... 30 1.4 At5g20690.1 68418.m02457 leucine-rich repeat transmembrane prote... 30 1.9 At4g37810.1 68417.m05350 expressed protein 30 1.9 At4g00610.1 68417.m00085 DNA-binding storekeeper protein-related... 30 1.9 At1g56660.1 68414.m06516 expressed protein 30 1.9 At2g46490.1 68415.m05786 expressed protein (APS2) identical to c... 29 2.5 At5g04890.1 68418.m00513 small heat shock-like protein (RTM2) si... 29 3.3 At4g27890.1 68417.m04003 nuclear movement family protein contain... 29 3.3 At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR ... 29 4.3 At4g14605.1 68417.m02247 mitochondrial transcription termination... 29 4.3 At4g04220.1 68417.m00598 disease resistance family protein conta... 29 4.3 At2g32680.1 68415.m03995 disease resistance family protein conta... 29 4.3 At1g72460.1 68414.m08379 leucine-rich repeat transmembrane prote... 29 4.3 At4g36080.1 68417.m05136 FAT domain-containing protein / phospha... 28 5.7 At3g42880.1 68416.m04495 leucine-rich repeat transmembrane prote... 28 5.7 At1g08290.1 68414.m00915 zinc finger (C2H2 type) protein (WIP3) ... 28 5.7 At4g37920.1 68417.m05362 expressed protein 28 7.5 At4g24760.1 68417.m03545 expressed protein 28 7.5 At3g20190.1 68416.m02559 leucine-rich repeat transmembrane prote... 28 7.5 At1g74180.1 68414.m08591 leucine-rich repeat family protein cont... 28 7.5 At1g70940.1 68414.m08184 auxin transport protein, putative (PIN3... 28 7.5 At1g51220.1 68414.m05761 zinc finger (C2H2 type) protein (WIP5) ... 28 7.5 At1g34790.1 68414.m04337 transparent testa 1 protein (TT1) / zin... 28 7.5 At1g33950.1 68414.m04208 avirulence-responsive family protein / ... 28 7.5 At1g02290.1 68414.m00171 expressed protein 28 7.5 At4g33330.1 68417.m04740 glycogenin glucosyltransferase (glycoge... 27 9.9 At4g28490.1 68417.m04076 leucine-rich repeat transmembrane prote... 27 9.9 At4g15230.1 68417.m02333 ABC transporter family protein similar ... 27 9.9 At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, put... 27 9.9 At2g14960.1 68415.m01701 auxin-responsive GH3 family protein sim... 27 9.9 >At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, putative identical to U2 small nuclear ribonucleoprotein A' (U2 snRNP-A') [Arabidopsis thaliana] SWISS-PROT:P43333; supported by cDNA:gi_16649064_gb_AY059902.1_ Length = 249 Score = 194 bits (473), Expect = 5e-50 Identities = 97/202 (48%), Positives = 138/202 (68%), Gaps = 2/202 (0%) Frame = +3 Query: 6 KIPQIENLGATLDQFDTIDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRIGENLEHYIPN 185 KIP IENLGAT DQFDTID SDN+I KL+ FP L RL +L+NNNRI RI NL ++P Sbjct: 30 KIPVIENLGATEDQFDTIDLSDNEIVKLENFPYLNRLGTLLINNNRITRINPNLGEFLPK 89 Query: 186 LESVILTNNNISELGDLDPLSTLPKLRTLSLMHNPVANKNHYRAYVAFKMPELRLLDFRK 365 L S++LTNN + L ++DPL+++PKL+ LSL+ N + K +YR YV K+ LR+LDF K Sbjct: 90 LHSLVLTNNRLVNLVEIDPLASIPKLQYLSLLDNNITKKANYRLYVIHKLKSLRVLDFIK 149 Query: 366 IKQKERDEANTLFKSRKGKEIQREIAKK--AKTFVPGGNMPDPKVTNLTPQEIHKIREAI 539 IK KER EA +LF S++ +E ++++++ K N PKV T ++I I+ AI Sbjct: 150 IKAKERAEAASLFSSKEAEEEVKKVSREEVKKVSETAENPETPKVVAPTAEQILAIKAAI 209 Query: 540 KNASSLQEVERLTRMLQSGQIP 605 N+ +++E+ RL + L+ GQ+P Sbjct: 210 INSQTIEEIARLEQALKFGQVP 231 >At3g50690.1 68416.m05546 leucine-rich repeat family protein Length = 447 Score = 47.2 bits (107), Expect = 1e-05 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 1/107 (0%) Frame = +3 Query: 78 IRKLDGFPLLKRLKCILLNNNRI-VRIGENLEHYIPNLESVILTNNNISELGDLDPLSTL 254 + L+ FP L L+ ++L++NRI V + +E + + + L+NN I + DL PL+ L Sbjct: 60 VSSLEQFPRLGNLQKLILSDNRITVGLEFLVEAGLDSFCDLDLSNNRIQFVEDLAPLAEL 119 Query: 255 PKLRTLSLMHNPVANKNHYRAYVAFKMPELRLLDFRKIKQKERDEAN 395 KL +L L PV YR+ V + L+ LD + ER E++ Sbjct: 120 -KLVSLDLYECPVTRLKDYRSRVFGLIKTLKYLDKTDAEGNERPESD 165 >At4g03260.1 68417.m00445 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 677 Score = 40.3 bits (90), Expect = 0.001 Identities = 29/86 (33%), Positives = 43/86 (50%) Frame = +3 Query: 30 GATLDQFDTIDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTN 209 GA ++ S N I ++G L RL+ + L+ NRI+R+G L +L+ + L Sbjct: 437 GALPRGLHALNLSKNSISVIEGLRELTRLRVLDLSYNRILRLGHGLAS-CSSLKELYLAG 495 Query: 210 NNISELGDLDPLSTLPKLRTLSLMHN 287 N ISE ++ L L KL L L N Sbjct: 496 NKISE---IEGLHRLLKLTVLDLRFN 518 >At1g04210.1 68414.m00411 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1112 Score = 39.5 bits (88), Expect = 0.002 Identities = 26/84 (30%), Positives = 47/84 (55%), Gaps = 1/84 (1%) Frame = +3 Query: 39 LDQFDTIDFSDNDIRKLDG-FPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNN 215 L + +D S N I+ L L L + + +NR++ + L + NLES+ ++NN Sbjct: 175 LKSLEYLDLSFNKIKSLPNEIGYLSSLTFLKVAHNRLMELSPVLA-LLQNLESLDVSNNR 233 Query: 216 ISELGDLDPLSTLPKLRTLSLMHN 287 ++ L LD L+ +P+L+ L+L +N Sbjct: 234 LTTLHPLD-LNLMPRLQILNLRYN 256 >At4g34280.1 68417.m04873 transducin family protein / WD-40 repeat family protein similar to TUPA (GI:11066216) [Emericella nidulans]; similar to damage-specific DNA binding protein 2, Homo sapiens ,PIR2:I38909; contains Pfam PF00400: WD domain, G-beta repeat (3 copies,1 weak)|19797453|gb|AU229277.1|AU229277 Length = 783 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/44 (34%), Positives = 30/44 (68%) Frame = +3 Query: 261 LRTLSLMHNPVANKNHYRAYVAFKMPELRLLDFRKIKQKERDEA 392 L+ +S +P+ ++ HYR Y+ +P+L++LD I++ +RD+A Sbjct: 324 LKYISSKASPICSEKHYRMYMINSLPKLQVLDNLAIRKSDRDKA 367 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +3 Query: 78 IRKLDGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISEL-GDLDPLSTL 254 I KL+ +L ++L+ NRIV GE+ +P L + + + +S+L L L Sbjct: 138 IHKLNIVGEFTQLHTLILDKNRIVGFGEDCFSCMPKLTYLSMCDTLVSDLWTSAAALLKL 197 Query: 255 PKLRTL 272 P L+ L Sbjct: 198 PSLKEL 203 >At1g71440.1 68414.m08253 tubulin folding cofactor E / Pfifferling (PFI) almost identical to tubulin folding cofactor E (Pfifferling; PFI) GI:20514267 from [Arabidopsis thaliana]; identical to cDNA tubulin folding cofactor E, GI:20514266 Length = 531 Score = 38.7 bits (86), Expect = 0.004 Identities = 27/119 (22%), Positives = 63/119 (52%), Gaps = 12/119 (10%) Frame = +3 Query: 72 NDIRKLDGFPLLKRLKCILLNNNRIVRIGENLEHY---------IPNLESVILTNNNISE 224 +++ KL P L++L LN N++ RI +++ P+L ++L NNI + Sbjct: 277 SEVLKLSQLPCLEQL---YLNKNKLSRIFQSVNGTESSEKGSDPFPSLSCLLLGANNIGD 333 Query: 225 LGDLDPLSTLPKLRTLSLMHNPVANK---NHYRAYVAFKMPELRLLDFRKIKQKERDEA 392 L +D L+ P+L + L NP+++ R + ++ ++++L+ +++ +E+ ++ Sbjct: 334 LASVDALNGFPQLVDIRLSENPISDPVRGGVPRFVLVARLTKVQVLNGSEVRAREKKDS 392 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 38.3 bits (85), Expect = 0.005 Identities = 38/147 (25%), Positives = 72/147 (48%), Gaps = 9/147 (6%) Frame = +3 Query: 9 IPQIENLGATLDQFDTIDFSD--NDIRKLD-GFPLLKRLKCIL----LNNNRIVRIGENL 167 +P +E+L + ++F +D N ++ LD GF L+++ + NN + + + Sbjct: 190 LPAVESLDLSRNKFAKVDNLRRCNKLKHLDLGFNQLRKISHLSEVGKFRNNALTTL-RGI 248 Query: 168 EHYIPNLESVILTNNNISELGDLDPLSTLPKLRTLSLMHNPVANKNHYRAYVA--FKMPE 341 E+ + +LE + ++ N IS+ +L+ L +L L L L NP+ YRA+V +P Sbjct: 249 EN-LKSLEGLDVSFNLISDFSELEFLGSLSFLTDLWLEGNPICCARWYRAHVLSYVYLPN 307 Query: 342 LRLLDFRKIKQKERDEANTLFKSRKGK 422 LD + I +E + + RK + Sbjct: 308 DLKLDGKHIGNREFWKRQVVVTRRKSQ 334 >At1g47890.1 68414.m05333 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1019 Score = 38.3 bits (85), Expect = 0.005 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 4/84 (4%) Frame = +3 Query: 48 FDTIDFSDNDIR-KL-DGFPLLKRLKCILLNNNRIV-RIGENLEHYIPNLESVILTNNNI 218 + ID S N + K+ D LLK L+ + +++N I +L + + NLES+ ++ NNI Sbjct: 833 YTAIDLSGNQLHGKIPDSIGLLKELRILNMSSNGFTGHIPSSLAN-LKNLESLDISQNNI 891 Query: 219 SELGDLDP-LSTLPKLRTLSLMHN 287 S G++ P L TL L +++ HN Sbjct: 892 S--GEIPPELGTLSSLAWINVSHN 913 >At1g78230.1 68414.m09116 leucine-rich repeat family protein Length = 676 Score = 37.9 bits (84), Expect = 0.007 Identities = 27/80 (33%), Positives = 43/80 (53%) Frame = +3 Query: 57 IDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELGDL 236 ++ S N I ++G L RL+ + L+ NRI RIG+ L + ++ + L N IS ++ Sbjct: 473 LNLSKNKISVIEGLRDLTRLRVLDLSYNRISRIGQGLSN-CTLIKELYLAGNKIS---NV 528 Query: 237 DPLSTLPKLRTLSLMHNPVA 296 + L L KL L L N +A Sbjct: 529 EGLHRLLKLIVLDLSFNKIA 548 >At5g22320.1 68418.m02604 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 452 Score = 36.7 bits (81), Expect = 0.016 Identities = 23/76 (30%), Positives = 40/76 (52%) Frame = +3 Query: 66 SDNDIRKLDGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELGDLDPL 245 +DN+I + LLK L ++L+ N I IG++L + NL + L++ I +G L Sbjct: 115 NDNEISSICKLDLLKDLNSLVLSRNPISEIGDSLSK-LKNLSKISLSDCRIKAIG--SSL 171 Query: 246 STLPKLRTLSLMHNPV 293 + L+ L L +N + Sbjct: 172 KSCSDLKELRLANNEI 187 >At1g48540.2 68414.m05428 leucine-rich repeat family protein Length = 1051 Score = 36.3 bits (80), Expect = 0.021 Identities = 33/128 (25%), Positives = 64/128 (50%), Gaps = 3/128 (2%) Frame = +3 Query: 6 KIPQIENLGATLDQFDTIDFSDNDIRKLDGFPLLK-RLKCILLNNNRIVRIGENLEHYIP 182 K +++NL + +D N +R + + L ++L NN + + +E+ + Sbjct: 202 KFVKVDNL-RRCTKLKHLDLGFNHLRTVSYLSQVSCHLVKLVLRNNALTTL-RGIEN-LK 258 Query: 183 NLESVILTNNNISELGDLDPLSTLPKLRTLSLMHNPVANKNHYRAYV--AFKMPELRLLD 356 +L+ + ++ N IS +L+ L +L +L+ L L NPV YRA+V +P+ LD Sbjct: 259 SLQGLDVSYNIISNFSELEFLWSLSQLKELWLEGNPVCCARWYRAHVFSYVALPDELKLD 318 Query: 357 FRKIKQKE 380 ++I +E Sbjct: 319 GKQIGTRE 326 >At1g48540.1 68414.m05427 leucine-rich repeat family protein Length = 1063 Score = 36.3 bits (80), Expect = 0.021 Identities = 33/128 (25%), Positives = 64/128 (50%), Gaps = 3/128 (2%) Frame = +3 Query: 6 KIPQIENLGATLDQFDTIDFSDNDIRKLDGFPLLK-RLKCILLNNNRIVRIGENLEHYIP 182 K +++NL + +D N +R + + L ++L NN + + +E+ + Sbjct: 202 KFVKVDNL-RRCTKLKHLDLGFNHLRTVSYLSQVSCHLVKLVLRNNALTTL-RGIEN-LK 258 Query: 183 NLESVILTNNNISELGDLDPLSTLPKLRTLSLMHNPVANKNHYRAYV--AFKMPELRLLD 356 +L+ + ++ N IS +L+ L +L +L+ L L NPV YRA+V +P+ LD Sbjct: 259 SLQGLDVSYNIISNFSELEFLWSLSQLKELWLEGNPVCCARWYRAHVFSYVALPDELKLD 318 Query: 357 FRKIKQKE 380 ++I +E Sbjct: 319 GKQIGTRE 326 >At1g72180.1 68414.m08346 leucine-rich repeat transmembrane protein kinase, putative similar to GI:3641252 from [Malus x domestica] (Plant Mol. Biol. 40 (6), 945-957 (1999)) Length = 977 Score = 34.3 bits (75), Expect = 0.087 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 8/74 (10%) Frame = +3 Query: 57 IDFSDNDI--RKLDGFPLLKRLKCILLNNNRIV-RIGENLEHYIPNLESVILTNNNIS-- 221 ID SDN++ L L ++L NNR +I L + N+E + L+NNN+S Sbjct: 415 IDLSDNELTGEVSPQIGLSTELSQLILQNNRFSGKIPRELGR-LTNIERIYLSNNNLSGE 473 Query: 222 ---ELGDLDPLSTL 254 E+GDL LS+L Sbjct: 474 IPMEVGDLKELSSL 487 >At2g33080.1 68415.m04056 leucine-rich repeat family protein contains leucine rich-repeat domain Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 740 Score = 33.5 bits (73), Expect = 0.15 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 4/94 (4%) Frame = +3 Query: 39 LDQFDTIDFSDNDIRKL--DGFPLLKRLKCILLNNNRIV-RIGENLEHYIPNLESVILTN 209 L+ + IDFS N + LLK L + L+NN I +L + LES+ L+ Sbjct: 601 LNSYSAIDFSGNRLEGQIPKSIGLLKELIALNLSNNAFTCHIPLSLAN-ATELESLDLSR 659 Query: 210 NNISELGDL-DPLSTLPKLRTLSLMHNPVANKNH 308 N +S G + + L TL L +++ HN + +NH Sbjct: 660 NQLS--GTIPNGLKTLSFLAYINVSHNKLKGENH 691 >At3g23010.1 68416.m02901 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 595 Score = 30.7 bits (66), Expect = 1.1 Identities = 32/95 (33%), Positives = 48/95 (50%), Gaps = 3/95 (3%) Frame = +3 Query: 48 FDTIDFSDNDIR-KLDG-FPLLKRLKCILLNNNRIV-RIGENLEHYIPNLESVILTNNNI 218 F+ IDFS N + G LL L+ + L+ N I +L + I NLES+ L+ NN+ Sbjct: 430 FNAIDFSGNRFSGHIPGSIGLLSELRLLNLSGNAFTGNIPPSLAN-ITNLESLDLSRNNL 488 Query: 219 SELGDLDPLSTLPKLRTLSLMHNPVANKNHYRAYV 323 S G++ P+S L LS + N + NH + Sbjct: 489 S--GEI-PIS----LGKLSFLSNTNFSYNHLEGLI 516 >At4g24490.1 68417.m03510 geranylgeranyl transferase alpha subunit-related / RAB geranylgeranyltransferase alpha subunit-related low similarity to SP|Q08602 [Rattus norvegicus] Length = 683 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/58 (25%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Frame = +3 Query: 57 IDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRIG--ENLEHYIPNLESVILTNNNISE 224 +D S N++ +G ++ L C+ L++NRI ++L H + L+ + +++N+I + Sbjct: 543 LDLSHNELHSTEGLEAMQLLSCLNLSHNRIRSFSALDSLRH-VKQLKVLDVSHNHIGK 599 >At1g17440.2 68414.m02133 transcription initiation factor IID (TFIID) subunit A family protein similar to SP|Q16514 Transcription initiation factor TFIID 20/15 kDa subunits (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 683 Score = 30.3 bits (65), Expect = 1.4 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 15/92 (16%) Frame = +3 Query: 420 KEIQREIAKKAKTFVPGGNMPDPKVTNLTPQEIHKIREAI-----------KNASSLQEV 566 K+I + K +PG + D + T P ++HK R A+ NAS+ +E Sbjct: 584 KDILLHLEKNLHLTIPGFSSEDKRQTKTVPTDLHKKRLAMVRALLESSKPETNASNSKET 643 Query: 567 ERLTRMLQSGQ----IPGQKPLQPVTQTNGQH 650 R + +G P Q Q V+QT+G H Sbjct: 644 MRQAMVNPNGPNHLLRPSQSSEQLVSQTSGPH 675 >At1g17440.1 68414.m02132 transcription initiation factor IID (TFIID) subunit A family protein similar to SP|Q16514 Transcription initiation factor TFIID 20/15 kDa subunits (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 683 Score = 30.3 bits (65), Expect = 1.4 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 15/92 (16%) Frame = +3 Query: 420 KEIQREIAKKAKTFVPGGNMPDPKVTNLTPQEIHKIREAI-----------KNASSLQEV 566 K+I + K +PG + D + T P ++HK R A+ NAS+ +E Sbjct: 584 KDILLHLEKNLHLTIPGFSSEDKRQTKTVPTDLHKKRLAMVRALLESSKPETNASNSKET 643 Query: 567 ERLTRMLQSGQ----IPGQKPLQPVTQTNGQH 650 R + +G P Q Q V+QT+G H Sbjct: 644 MRQAMVNPNGPNHLLRPSQSSEQLVSQTSGPH 675 >At5g20690.1 68418.m02457 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase PRK1, tomato, PIR:T07865 Length = 659 Score = 29.9 bits (64), Expect = 1.9 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 3/70 (4%) Frame = +3 Query: 87 LDGFPLLKRLKCILLNNNRIVRIGENLEHY--IPNLESVILTNNNIS-ELGDLDPLSTLP 257 +D L LK I L+NN + L H+ + L+S++L+NN+ S E+ D D + Sbjct: 89 VDDLKDLPNLKTIRLDNNLL---SGPLPHFFKLRGLKSLMLSNNSFSGEIRD-DFFKDMS 144 Query: 258 KLRTLSLMHN 287 KL+ L L HN Sbjct: 145 KLKRLFLDHN 154 >At4g37810.1 68417.m05350 expressed protein Length = 128 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 169 SKFSPILTILLLFNRIHFNLFSSGKP 92 S S L ILL+ N HF+L ++G+P Sbjct: 5 SNMSSFLLILLILNSTHFSLMANGRP 30 >At4g00610.1 68417.m00085 DNA-binding storekeeper protein-related similar to storekeeper protein GI:14268476 [Solanum tuberosum] Length = 328 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +3 Query: 495 TNLTPQEIHKIREAIKNASSLQEVERLTRMLQSGQIPGQKPLQPVTQTNGQHEDE-EMDT 671 T +TP + K + + L V + P +KPL+ V T+ + E+E E + Sbjct: 35 TLVTPSTVKKSSDVASTSKKLSGVASPAKKPSGVTSPVKKPLEAVASTSSEEEEEDEPSS 94 Query: 672 DQANG 686 D +G Sbjct: 95 DSESG 99 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +3 Query: 285 NPVANKNHYRAYVAFKMPELRLLDFRKIKQKERDEANTLFKSRKGKEIQRE 437 N A+K V+ + EL D +K K+KE+DE+ T K +K K+ +++ Sbjct: 150 NKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDESGTEEKKKKPKKEKKQ 200 >At2g46490.1 68415.m05786 expressed protein (APS2) identical to cDNA Aps2, partial cds GI:4519894 Length = 134 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = -2 Query: 130 NRIHFNLFSSGKPSSFLMSLSEKSIVSN*SSVAP 29 N + NLFSS SS L SLS S +SN +S P Sbjct: 75 NIMAMNLFSSSSSSSNLQSLSSSSSLSNLASDLP 108 >At5g04890.1 68418.m00513 small heat shock-like protein (RTM2) similar to 17.9 kDa heat-shock protein [Helianthus annuus] GI:11990130; contains Pfam profile PF00011: Hsp20/alpha crystallin family; supporting cDNA gi|7407072|gb|AF208051.1|AF208051; identical to cDNA small heat shock-like protein (RTM2) GI:7407072, small heat shock-like protein [Arabidopsis thaliana] GI:7407073 Length = 366 Score = 29.1 bits (62), Expect = 3.3 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 3/72 (4%) Frame = +3 Query: 249 TLPKLRTLSLMHNPVANKNHYRAYV-AFKMPELRLLDFRKIKQKERDEANTLFKS--RKG 419 T+PK + + P ++ A A K+ E RLL+ + K+KE +EA + K + Sbjct: 100 TMPKETITKVAYLPETSRTEAAALEKAAKLEEKRLLEESRRKEKEEEEAKQMKKQLLEEK 159 Query: 420 KEIQREIAKKAK 455 + + R++ ++AK Sbjct: 160 EALIRKLQEEAK 171 >At4g27890.1 68417.m04003 nuclear movement family protein contains Pfam profile: PF03593 nuclear movement protein Length = 293 Score = 29.1 bits (62), Expect = 3.3 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 2/83 (2%) Frame = +3 Query: 372 QKERDEANTLFKSRKGKEIQREIAKKA--KTFVPGGNMPDPKVTNLTPQEIHKIREAIKN 545 +K+ E + K+ RE KK K V + PK +L P E+ K +E Sbjct: 45 KKDTAEKEIVAAVMAAKQRLREAEKKKLEKESVKSMEVEKPKKDSLKPTELEKPKEESLM 104 Query: 546 ASSLQEVERLTRMLQSGQIPGQK 614 A+ E+E+ +SG I K Sbjct: 105 ATDPMEIEKPKEEKESGPIVPNK 127 >At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 874 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +3 Query: 111 RLKCILLNNNRIVRIGENLEHYIPNLESVILT-NNNISELGDLDPLSTL 254 +L+ +LL +NR+ +I ++P L + L+ N N+ EL PL +L Sbjct: 528 KLETLLLRDNRLRKISREFLSHVPILMVLDLSLNPNLIELPSFSPLYSL 576 >At4g14605.1 68417.m02247 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 444 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 2/69 (2%) Frame = -3 Query: 201 KSQTLNLVYNVPNSLLSSRSCYYS-IEYIS-TFLAVENRQAF*CRCPRSLSYQIDRA*HP 28 K+Q ++ P L SR S +E++S T L E RCP +SY ++ P Sbjct: 282 KNQWAKIISRFPAILTYSRQKLTSTVEFLSQTGLTEEQIGRILTRCPNIMSYSVEDKLRP 341 Query: 27 DFRFVESYN 1 + S N Sbjct: 342 TMEYFRSLN 350 >At4g04220.1 68417.m00598 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-2A [Lycopersicon pimpinellifolium] gi|3894389|gb|AAC78594 Length = 811 Score = 28.7 bits (61), Expect = 4.3 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 5/109 (4%) Frame = +3 Query: 39 LDQFDTIDFSDNDIRKL--DGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNN 212 L + TID +N + D L L + L+ N++ + H + NLE++ L NN Sbjct: 225 LTKLKTIDLQNNFLSSKIPDDIGNLVNLSTLSLSMNKLSGGIPSSIHNLKNLETLQLENN 284 Query: 213 NISELGDLDP--LSTLPKLRTLSLM-HNPVANKNHYRAYVAFKMPELRL 350 N G++ L L KL+ L L +N + N+ + FK+ L L Sbjct: 285 N-GLSGEIPAAWLFGLQKLKVLRLEGNNKLQWNNNGYVFPQFKLTHLSL 332 >At2g32680.1 68415.m03995 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 890 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 183 NLESVILTNNNISELGDL-DPLSTLPKLRTLSLMHNPVANK 302 NLE V L NNN+ G + D L LRTL + HN + K Sbjct: 529 NLELVYLRNNNLE--GSIPDALCDGASLRTLDVSHNRLTGK 567 >At1g72460.1 68414.m08379 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profiles: PF00560 leucine rich repeat (5 copies), PF00069 eukaryotic protein kinase domain Length = 644 Score = 28.7 bits (61), Expect = 4.3 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 2/85 (2%) Frame = +3 Query: 39 LDQFDTIDFSDNDIR-KLDGFPLLKRLKCILLNNNRIV-RIGENLEHYIPNLESVILTNN 212 L TI +N + F L LK + ++ NR I + + +L+ L+NN Sbjct: 89 LPSLRTISIMNNSFSGDIPEFNRLTALKSLYISGNRFSGNIPSDYFETMVSLKKAWLSNN 148 Query: 213 NISELGDLDPLSTLPKLRTLSLMHN 287 + S L + +TLP L L L +N Sbjct: 149 HFSGLIPISLATTLPNLIELRLENN 173 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 231 DLDPLSTLPKLRTLSLMHN 287 D+ PL LP LRT+S+M+N Sbjct: 82 DVAPLKDLPSLRTISIMNN 100 >At4g36080.1 68417.m05136 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF00454: Phosphatidylinositol 3- and 4-kinase, PF02259: FAT domain, PF02260: FATC domain Length = 3839 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/65 (27%), Positives = 37/65 (56%) Frame = +3 Query: 51 DTIDFSDNDIRKLDGFPLLKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELG 230 + +D ++ND R+ +++ L L N+N + + +N+++ + L S T + +SEL Sbjct: 1183 NNVDEANNDARRQSFQDVVEYLATELFNSNASITVRKNVQNCLALLAS--RTGSEVSEL- 1239 Query: 231 DLDPL 245 L+PL Sbjct: 1240 -LEPL 1243 >At3g42880.1 68416.m04495 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase PRK1, Lycopersicon esculentum, PIR:T07865 Length = 633 Score = 28.3 bits (60), Expect = 5.7 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 2/68 (2%) Frame = +3 Query: 105 LKRLKCILLNNNRIVRIGENLEHY-IPNLESVILTNNNIS-ELGDLDPLSTLPKLRTLSL 278 L L+ I L+NN + G + +P L+S++L+NN+ S E+ D D P+L+ + L Sbjct: 90 LPNLRTIRLDNNLLS--GPLPPFFKLPGLKSLLLSNNSFSGEIAD-DFFKETPQLKRVFL 146 Query: 279 MHNPVANK 302 +N ++ K Sbjct: 147 DNNRLSGK 154 >At1g08290.1 68414.m00915 zinc finger (C2H2 type) protein (WIP3) identical to WIP3 protein [Arabidopsis thaliana] gi|18027014|gb|AAL55723; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 337 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -1 Query: 332 FECHICPIMVFV-GNWIVHE**CSQLW*CT 246 F C C + V G+W HE C +LW CT Sbjct: 265 FSCGKCGKALAVKGDWRTHEKNCGKLWYCT 294 >At4g37920.1 68417.m05362 expressed protein Length = 673 Score = 27.9 bits (59), Expect = 7.5 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 2/75 (2%) Frame = +3 Query: 450 AKTFVPGGN--MPDPKVTNLTPQEIHKIREAIKNASSLQEVERLTRMLQSGQIPGQKPLQ 623 A F PG + DPK TP+E+HK + + +A L + E T + ++ Q+ +Q Sbjct: 577 ATAFSPGDDHEAKDPKALYTTPKELHKWIKIMLDAYHLNKEE--TDIKEAKQMSQPIVIQ 634 Query: 624 PVTQTNGQHEDEEMD 668 + EDE +D Sbjct: 635 RLFILKDTIEDEYLD 649 >At4g24760.1 68417.m03545 expressed protein Length = 365 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +3 Query: 168 EHYIPNLESVILTNNNISELGDLDPLSTLPKLRTLSLMHNPV 293 E+Y E++IL ++ +D + LP+LR S++H+P+ Sbjct: 132 ENYGAKQENIILYGQSVGSGPTVDLAARLPRLRA-SILHSPI 172 >At3g20190.1 68416.m02559 leucine-rich repeat transmembrane protein kinase, putative similar to receptor kinase GB:AAA33715 [Petunia integrifolia] Length = 679 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 231 DLDPLSTLPKLRTLSLMHN 287 DL+PL+ + LRTLS M+N Sbjct: 111 DLEPLAAIKNLRTLSFMNN 129 >At1g74180.1 68414.m08591 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-0B [Lycopersicon esculentum] gi|3894387|gb|AAC78593 Length = 951 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = +3 Query: 105 LKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNISELGDLDPLSTLPKLRTLSL 278 L +L+ + L++N++ + + +LE + L++NN L+PL+ L KL+ L Sbjct: 258 LNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRL 315 >At1g70940.1 68414.m08184 auxin transport protein, putative (PIN3) similar to auxin transport protein [Arabidopsis thaliana] gi|5817301|gb|AAD52695 Length = 640 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/37 (32%), Positives = 24/37 (64%), Gaps = 5/37 (13%) Frame = +2 Query: 509 SRNP*DPRSNQECIIPTGGRTS-----DKNVAVWSDS 604 ++NP D +NQ+ +PTGG+++ + ++ VWS + Sbjct: 328 NKNPKDVNTNQQTTLPTGGKSNSHDAKELHMFVWSSN 364 >At1g51220.1 68414.m05761 zinc finger (C2H2 type) protein (WIP5) identical to WIP5 protein [Arabidopsis thaliana] gi|18376498|emb|CAC86167; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 337 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -1 Query: 332 FECHICPIMVFV-GNWIVHE**CSQLW*CT 246 F C +C V G+W HE C +LW C+ Sbjct: 262 FACRMCGKAFAVKGDWRTHEKNCGKLWYCS 291 >At1g34790.1 68414.m04337 transparent testa 1 protein (TT1) / zinc finger (C2H2 type) protein TT1 identical to transparent testa 1 GI:18253279 from [Arabidopsis thaliana]; contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 303 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 332 FECHICPIMVFV-GNWIVHE**CSQLW*C 249 F C +C ++ V G+W HE C + W C Sbjct: 229 FSCRLCGKLLAVKGDWRTHEKNCGKRWVC 257 >At1g33950.1 68414.m04208 avirulence-responsive family protein / avirulence induced gene (AIG1) family protein similar to AIG1 protein SP:P54120 (Arabidopsis thaliana), NTGP4 GB:AAD09518 (Nicotiana tabacum); contains Pfam profile: PF00735 cell division protein (members of this family bind GTP) Length = 311 Score = 27.9 bits (59), Expect = 7.5 Identities = 18/72 (25%), Positives = 30/72 (41%) Frame = +1 Query: 526 SEKQSRMHHPYRRSNV*QECCSLVRFQGKNLYSP*HKQMVNMKMRKWTRIKQTDSS*VNK 705 SEK + H N +EC + ++ Q LY KQM +K + ++K Sbjct: 225 SEKLRKHHEELESKNYSEECAAEMKNQSLILYKENLKQMSEQLEKKLKDAAEAQEKALSK 284 Query: 706 IHSLNMRIKLAV 741 + N + LA+ Sbjct: 285 MTQENNELNLAL 296 >At1g02290.1 68414.m00171 expressed protein Length = 443 Score = 27.9 bits (59), Expect = 7.5 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +3 Query: 342 LRLLDFRKIKQKERDEANTLFKS-RKGKEIQREIAKKAKTFVPGGNMPDPKVTNLTPQEI 518 L+LLD ++ KE D A FK+ K ++R K+ TF G+ + +T + + Sbjct: 178 LKLLDLNRVPSKEMDSATCRFKTPNVVKPVERN-RSKSLTFPRSGSSKNSLKIKITKEGV 236 Query: 519 HK 524 + Sbjct: 237 FR 238 >At4g33330.1 68417.m04740 glycogenin glucosyltransferase (glycogenin)-related similar to glycogenin glucosyltransferase (glycogenin-1) (EC 2.4.1.186) from Homo sapiens [SP|P46976], Mus musculus [SP|Q9R062], Oryctolagus cuniculus [GI:165513]; contains Pfam profile PF01501: Glycosyl transferase family 8 Length = 593 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 258 KLRTLSLMHNPVANKNHYRAYVAFKMPELRLLDFRKI 368 KLR + + NP+A K+ Y Y K +L D+ K+ Sbjct: 352 KLRRIIRIRNPLAEKDSYNEYNYSKFRLWQLTDYDKV 388 >At4g28490.1 68417.m04076 leucine-rich repeat transmembrane protein kinase, putative Length = 999 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +3 Query: 174 YIPNLESVILTNNNISELGDLDPLSTLPKLRTLSLMHNPVANKNHYRAYVAFKMPELRLL 353 ++P+L S+ L NN+I+ D T L +L L N + + F +P L+ L Sbjct: 87 HLPSLHSLSLYNNSINGSLSADDFDTCHNLISLDLSENLLVGS--IPKSLPFNLPNLKFL 144 Query: 354 D 356 + Sbjct: 145 E 145 >At4g15230.1 68417.m02333 ABC transporter family protein similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1326 Score = 27.5 bits (58), Expect = 9.9 Identities = 25/98 (25%), Positives = 40/98 (40%), Gaps = 7/98 (7%) Frame = +3 Query: 144 IVRIGENLEHYIPNLESVILTNNNISELGDL-------DPLSTLPKLRTLSLMHNPVANK 302 +++ GE E +LE + N + + +L + L T ++ T L + V+ K Sbjct: 1 MIQTGEEDEEKATSLEVEFASGNGVDDEEELRLQWATVERLPTFKRVTTALLARDEVSGK 60 Query: 303 NHYRAYVAFKMPELRLLDFRKIKQKERDEANTLFKSRK 416 + E RLL +KQ E D L K RK Sbjct: 61 GRVIDVTRLEGAERRLLIEMLVKQIEDDNLRLLRKIRK 98 >At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, putative (ERECTA) identical to uncharacterized receptor protein kinase ERECTA [Arabidopsis thaliana] gi|1389566|dbj|BAA11869; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 976 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +3 Query: 57 IDFSDNDIRKLDGFPL--LKRLKCILLNNNRIVRIGENLEHYIPNLESVILTNNNIS 221 +D S N++ F + LK+L+ ++L NN+++ + IPNL+ + L N +S Sbjct: 121 LDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLS 177 >At2g14960.1 68415.m01701 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 590 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 237 PNHQVLRYCCLLKSQTLNLVY 175 P+H+ L CCL ++LN VY Sbjct: 492 PSHETLTRCCLGMEESLNSVY 512 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,925,360 Number of Sequences: 28952 Number of extensions: 337936 Number of successful extensions: 1070 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 1021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1067 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -