BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11p12 (706 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3835| Best HMM Match : Cyt-b5 (HMM E-Value=4.8e-23) 103 1e-22 SB_34578| Best HMM Match : Cyt-b5 (HMM E-Value=4.8e-23) 103 1e-22 SB_6739| Best HMM Match : RCC1 (HMM E-Value=1.6e-34) 64 8e-11 SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) 62 6e-10 SB_58806| Best HMM Match : Cyt-b5 (HMM E-Value=2.2e-20) 61 7e-10 SB_49983| Best HMM Match : Cyt-b5 (HMM E-Value=8.4e-12) 58 9e-09 SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) 55 5e-08 SB_31956| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_23567| Best HMM Match : Neur_chan_LBD (HMM E-Value=0.00019) 31 0.91 SB_34637| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_58498| Best HMM Match : Mtc (HMM E-Value=3.00004e-41) 28 6.4 SB_40332| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_20978| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_42304| Best HMM Match : NHL (HMM E-Value=0) 28 6.4 >SB_3835| Best HMM Match : Cyt-b5 (HMM E-Value=4.8e-23) Length = 109 Score = 103 bits (248), Expect = 1e-22 Identities = 46/80 (57%), Positives = 57/80 (71%) Frame = +1 Query: 211 KNLTLDEVKKHKDEKSVWIIIHNDVYDVTKFLEEHPGGADSLLEVAGKDGTQAFEDVGHS 390 K T DEVK H W++IHN V+DVTKFL+EHPGG + LLE AG D +++FEDVGHS Sbjct: 8 KLYTFDEVKNHNKAGGCWLVIHNKVFDVTKFLDEHPGGEEVLLEQAGGDASESFEDVGHS 67 Query: 391 DDARELLKKYKIGTLPPGER 450 DAREL+ +Y IG L +R Sbjct: 68 SDARELMNEYCIGELREADR 87 >SB_34578| Best HMM Match : Cyt-b5 (HMM E-Value=4.8e-23) Length = 172 Score = 103 bits (248), Expect = 1e-22 Identities = 46/80 (57%), Positives = 57/80 (71%) Frame = +1 Query: 211 KNLTLDEVKKHKDEKSVWIIIHNDVYDVTKFLEEHPGGADSLLEVAGKDGTQAFEDVGHS 390 K T DEVK H W++IHN V+DVTKFL+EHPGG + LLE AG D +++FEDVGHS Sbjct: 8 KLYTFDEVKNHNKAGGCWLVIHNKVFDVTKFLDEHPGGEEVLLEQAGGDASESFEDVGHS 67 Query: 391 DDARELLKKYKIGTLPPGER 450 DAREL+ +Y IG L +R Sbjct: 68 SDARELMNEYCIGELREADR 87 >SB_6739| Best HMM Match : RCC1 (HMM E-Value=1.6e-34) Length = 1790 Score = 64.5 bits (150), Expect = 8e-11 Identities = 26/69 (37%), Positives = 44/69 (63%) Frame = +1 Query: 226 DEVKKHKDEKSVWIIIHNDVYDVTKFLEEHPGGADSLLEVAGKDGTQAFEDVGHSDDARE 405 ++++ H E +W++IH VYD+ +F EE P G L + A D T+AFE+ HS +AR Sbjct: 1234 EDLENHNKEGGMWVVIHGKVYDLKEFKEEAPCGESLLQKYAACDATKAFEEANHSYEARM 1293 Query: 406 LLKKYKIGT 432 +++ + +GT Sbjct: 1294 MMQDHLVGT 1302 >SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) Length = 167 Score = 61.7 bits (143), Expect = 6e-10 Identities = 33/79 (41%), Positives = 43/79 (54%), Gaps = 3/79 (3%) Frame = +1 Query: 226 DEVKKHKDEKSVWIIIHNDVYDVTKFLEEHPGGADSLLEVAGKDGTQAF---EDVGHSDD 396 +E+ +HK + +W+I VYD++KF E HPGG D LL +G+D T E HS Sbjct: 13 EEIGRHKSDGDLWVIHSGKVYDISKFSERHPGGKDVLLLNSGQDVTSIMSNGEIHKHSQI 72 Query: 397 ARELLKKYKIGTLPPGERC 453 A LKKY IG L C Sbjct: 73 AYGWLKKYNIGRLQAELSC 91 >SB_58806| Best HMM Match : Cyt-b5 (HMM E-Value=2.2e-20) Length = 142 Score = 61.3 bits (142), Expect = 7e-10 Identities = 31/93 (33%), Positives = 52/93 (55%) Frame = +1 Query: 199 RKMSKNLTLDEVKKHKDEKSVWIIIHNDVYDVTKFLEEHPGGADSLLEVAGKDGTQAFED 378 R+ K TLDEVK+H + W+++ + VYD++K++ HPGG +L +AG++ T F+ Sbjct: 7 RRTPKVYTLDEVKEHCSKGDCWVVVEDSVYDLSKWIGHHPGGELPILYMAGRECTDVFKA 66 Query: 379 VGHSDDARELLKKYKIGTLPPGERCKIITDCSK 477 + + L +KIG L + K T S+ Sbjct: 67 FHPAWVFTKKLPAFKIGKLDDTRKEKKETSLSE 99 >SB_49983| Best HMM Match : Cyt-b5 (HMM E-Value=8.4e-12) Length = 303 Score = 57.6 bits (133), Expect = 9e-09 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 3/79 (3%) Frame = +1 Query: 208 SKNLTLDEVKKHKDEK-SVWIIIHNDVYDVTKFLEEHPGGADSLLEVAGK--DGTQAFED 378 S+ +L EV KH D + VW + VYD+T F+E+HPGG ++ AG D D Sbjct: 155 SRTFSLSEVAKHTDARHGVWTTYEDGVYDLTDFIEQHPGGKKMIMLAAGSRLDPYWNIHD 214 Query: 379 VGHSDDARELLKKYKIGTL 435 DD ++L +++IG+L Sbjct: 215 FHKRDDIVKILSEFRIGSL 233 >SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) Length = 672 Score = 55.2 bits (127), Expect = 5e-08 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 3/79 (3%) Frame = +1 Query: 208 SKNLTLDEVKKHKDEKS-VWIIIHNDVYDVTKFLEEHPGGADSLLEVAGK--DGTQAFED 378 +K + +EV KH + KS +W+ VYD+T F++ HPGG ++ AG + A Sbjct: 201 AKIYSKEEVSKHNNRKSRIWVTYKGGVYDITDFIDGHPGGTSKIILAAGAALEPYWAMYA 260 Query: 379 VGHSDDARELLKKYKIGTL 435 V ++ E+L++Y+IG L Sbjct: 261 VHKKEEVLEILEEYRIGDL 279 >SB_31956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 51.2 bits (117), Expect = 8e-07 Identities = 24/56 (42%), Positives = 33/56 (58%) Frame = +1 Query: 208 SKNLTLDEVKKHKDEKSVWIIIHNDVYDVTKFLEEHPGGADSLLEVAGKDGTQAFE 375 +K T ++ + E++ + IH VYDVT FL HPGG + LL AG+D T FE Sbjct: 22 TKTFTWQQLSRLNTEQNAHLAIHGKVYDVTNFLLRHPGGKELLLIGAGRDVTLVFE 77 >SB_23567| Best HMM Match : Neur_chan_LBD (HMM E-Value=0.00019) Length = 653 Score = 31.1 bits (67), Expect = 0.91 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +3 Query: 474 EIEMGSGGAGWSLAHRDRPQEISQLIKL*AEHILRESDR 590 E ++G+G +G SLA P+++ ++ AEH RE+ R Sbjct: 576 ETDLGTGNSGPSLAVLSNPRDLDVSLEFIAEHSRREAQR 614 >SB_34637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +1 Query: 355 DGTQAFEDVGHSDDARELLKKYKIGTLPPGER 450 D T+AFE+ HS +AR +++ + +GT E+ Sbjct: 3 DATKAFEEANHSYEARMMMQDHLVGTFVEPEQ 34 >SB_58498| Best HMM Match : Mtc (HMM E-Value=3.00004e-41) Length = 217 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 355 DGTQAFEDVGHSDDARELLKKYKIGTLPPG 444 D T++F DDA++L++KY+ G P G Sbjct: 29 DWTKSFHTNKELDDAKDLVEKYRRGEEPAG 58 >SB_40332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 355 DGTQAFEDVGHSDDARELLKKYKIGTLPPG 444 D T++F DDA++L++KY+ G P G Sbjct: 289 DWTKSFHTNKELDDAKDLVEKYRRGEEPAG 318 >SB_20978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1683 Score = 28.3 bits (60), Expect = 6.4 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = +2 Query: 305 WRSIQV-ELIHC*KWQGRMEPRLLKTWDIVMMLESC*RNTKLERCLQVKDAKSSQIVRN* 481 WR V L+ KW G EP LLK + M E+ + +E C + S RN Sbjct: 90 WRREYVPHLVQRSKWLGPSEPDLLKNIGVARMPET---RSNVENCRAKRKVVRSNCTRNI 146 Query: 482 N 484 N Sbjct: 147 N 147 >SB_42304| Best HMM Match : NHL (HMM E-Value=0) Length = 1279 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 5/56 (8%) Frame = -3 Query: 455 LHLSPGGNVPILYFFNNSRAS-----SLCPTSSKAWVPSFPATSNNESAPPGCSSK 303 L L+P GN+ I F NN S S+ P + + + PA N P G K Sbjct: 345 LALTPDGNICIADFRNNRYRSNETKLSIVPRAGRKLLQKLPANRNKSYPPTGLKCK 400 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,457,510 Number of Sequences: 59808 Number of extensions: 384466 Number of successful extensions: 974 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 872 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 973 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -