BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11p09 (610 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC139737-1|AAI39738.1| 263|Homo sapiens transmembrane protein 5... 31 3.2 AK056404-1|BAB71177.1| 263|Homo sapiens protein ( Homo sapiens ... 31 3.2 >BC139737-1|AAI39738.1| 263|Homo sapiens transmembrane protein 56 protein. Length = 263 Score = 31.1 bits (67), Expect = 3.2 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -2 Query: 474 TCFSFFRLLFIFYDFISPFFSYLIPLSFYVRSVKHSIN-NDDTRSNCYS 331 TC SFF +FY F+S +FS + F S K I N S C+S Sbjct: 12 TCISFFTFQLLFY-FVSYWFSAKVSPGFNSLSFKKKIEWNSRVVSTCHS 59 >AK056404-1|BAB71177.1| 263|Homo sapiens protein ( Homo sapiens cDNA FLJ31842 fis, clone NT2RP7000259. ). Length = 263 Score = 31.1 bits (67), Expect = 3.2 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -2 Query: 474 TCFSFFRLLFIFYDFISPFFSYLIPLSFYVRSVKHSIN-NDDTRSNCYS 331 TC SFF +FY F+S +FS + F S K I N S C+S Sbjct: 12 TCISFFTFQLLFY-FVSYWFSAKVSPGFNSLSFKKKIEWNSRVVSTCHS 59 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,043,521 Number of Sequences: 237096 Number of extensions: 1236532 Number of successful extensions: 2410 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2410 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6466646650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -