BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11p02 (725 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 4.2 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 4.2 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.2 bits (50), Expect = 4.2 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +2 Query: 281 KTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNG 418 KT AD RP + +IV YGF E Q+G + NG Sbjct: 1313 KTVVADFRPYR------ISEEIVTYYGFEPYEQNQIGSDGRWKWNG 1352 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.2 bits (50), Expect = 4.2 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +2 Query: 281 KTTEADLRPLFEKYGTVVECDIVRNYGFVHMENEQVGREAIQNLNG 418 KT AD RP + +IV YGF E Q+G + NG Sbjct: 1314 KTVVADFRPYR------ISEEIVTYYGFEPYEQNQIGSDGRWKWNG 1353 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,154 Number of Sequences: 2352 Number of extensions: 15833 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -