BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11o24 (159 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29118| Best HMM Match : GRP (HMM E-Value=8) 26 5.5 SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.6 >SB_29118| Best HMM Match : GRP (HMM E-Value=8) Length = 333 Score = 25.8 bits (54), Expect = 5.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 28 GCSQNDGKSNVDPGEYDKQG 87 GC +DG S VD G D G Sbjct: 46 GCGDSDGDSGVDSGSCDGDG 65 >SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2309 Score = 25.0 bits (52), Expect = 9.6 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 47 ESXMSTPVNTISRESLKVFITNNVFKKPLDFNSD 148 ES + N S + L F+T + K +DFNSD Sbjct: 1553 ESEEVSSDNESSSDLLMSFLTKSADKSSVDFNSD 1586 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,393,851 Number of Sequences: 59808 Number of extensions: 58851 Number of successful extensions: 87 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 16,821,457 effective HSP length: 32 effective length of database: 14,907,601 effective search space used: 298152020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -