BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11o19 (468 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC646.15c |||Pex16 family protein|Schizosaccharomyces pombe|ch... 26 3.3 SPAC12B10.06c |||DUF339 family protein|Schizosaccharomyces pombe... 25 4.4 >SPBC646.15c |||Pex16 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 376 Score = 25.8 bits (54), Expect = 3.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 164 QLNNIRTFKNFGHKKEPIPTVTFLWH 241 +L N+R F NF P+ + F+WH Sbjct: 212 RLPNLRIFSNFIKVCRPLIYMLFMWH 237 >SPAC12B10.06c |||DUF339 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 139 Score = 25.4 bits (53), Expect = 4.4 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +3 Query: 225 LLFCGMDSSPSHSWDCVSIGKELDHLYLTRRNMTIPVPE 341 L +C + W + KEL ++RN T+ +PE Sbjct: 99 LYWCSGEREAPEKWKSSQVFKELSKYCRSQRNHTLRMPE 137 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,943,363 Number of Sequences: 5004 Number of extensions: 39944 Number of successful extensions: 87 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 178394480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -