BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11o07 (287 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 20 5.3 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 20 5.3 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 20 7.0 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 20.2 bits (40), Expect = 5.3 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 194 VNRGHCKSIGVSNKKM 241 ++RGHC IG K++ Sbjct: 41 LDRGHCDVIGKKIKEL 56 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 20.2 bits (40), Expect = 5.3 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -3 Query: 249 IKHIFLLETPMLLQWPRLTYIIWNYSHLCSDTG 151 ++ +FL P LL R Y Y D+G Sbjct: 350 VRQVFLNWMPRLLMMRRTPYSTPEYDDTYMDSG 382 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 19.8 bits (39), Expect = 7.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 42 NFNNLIQFKTSNL 80 N NN+ FK SN+ Sbjct: 159 NGNNITNFKNSNI 171 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,681 Number of Sequences: 438 Number of extensions: 1285 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 5744526 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -