BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11o03 (427 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.92 SB_9077| Best HMM Match : Leu_leader (HMM E-Value=9.6) 27 4.9 SB_55996| Best HMM Match : DUF1694 (HMM E-Value=6.9) 27 6.5 >SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 29.9 bits (64), Expect = 0.92 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 235 NKSFCQKVLQRKLCKGGFM*YFNVCFNSENVNIVL 339 N FC+K +R KG Y NVC + V +V+ Sbjct: 177 NAYFCEKCNKRMTLKGNINQYNNVCLKKDLVQVVI 211 >SB_9077| Best HMM Match : Leu_leader (HMM E-Value=9.6) Length = 231 Score = 27.5 bits (58), Expect = 4.9 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +1 Query: 148 CMGLFYSLITFTSTSSMCGHRYKHPKQLLNKSFCQKVLQRKLCK 279 C L+YS T ++C H Q +N S C K L K+ K Sbjct: 19 CTRLYYSRCTRALLITVCKGSIAHDAQKVNYSRCAKALLLKVRK 62 >SB_55996| Best HMM Match : DUF1694 (HMM E-Value=6.9) Length = 167 Score = 27.1 bits (57), Expect = 6.5 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +2 Query: 182 QVLQVCAATDTSIQSSC*TRAFVRRFFRENYVKEDLCNILMFVLIVKM 325 +VL D SI F+RRF+R ++ K ++ F LIV M Sbjct: 27 RVLNSTTRNDESICRITIENCFLRRFYRPSHEKHHFFYVIPFRLIVFM 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,397,766 Number of Sequences: 59808 Number of extensions: 219405 Number of successful extensions: 551 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 814166562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -