BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11o01 (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 28 0.088 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 27 0.15 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 27 0.20 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 24 1.4 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 1.9 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 2.5 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 3.3 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 3.3 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 3.3 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 3.3 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 3.3 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 21 7.6 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 21 7.6 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 7.6 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.6 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 27.9 bits (59), Expect = 0.088 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -3 Query: 481 SPLQNCGKPVPPAGSSTPGRYRGAPPWTFGKTGVCIMICGTISGA 347 SPL G P+ S+ R++ P+T+G GV ++ ++GA Sbjct: 535 SPLSLLGGPLVMVCSAPVWRFQPWGPFTWGGIGVVVLFAVVLAGA 579 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 405 GGAPLYLPGVELPAGG 452 G L+ PG ELPA G Sbjct: 59 GANALFTPGQELPARG 74 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 27.1 bits (57), Expect = 0.15 Identities = 17/53 (32%), Positives = 22/53 (41%) Frame = -3 Query: 505 LLVCAAINSPLQNCGKPVPPAGSSTPGRYRGAPPWTFGKTGVCIMICGTISGA 347 LLV I+ P + CG P TP A WT + +C G +S A Sbjct: 126 LLVSLRIDLPWRTCGNPWNTRYCLTPTERLEALCWTQDEDVICSTPIGNLSHA 178 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 26.6 bits (56), Expect = 0.20 Identities = 17/53 (32%), Positives = 22/53 (41%) Frame = -3 Query: 505 LLVCAAINSPLQNCGKPVPPAGSSTPGRYRGAPPWTFGKTGVCIMICGTISGA 347 LLV I+ P + CG P TP A WT + +C G +S A Sbjct: 179 LLVSLRIDLPWRTCGNPWNTRYCLTPTERLEALCWTQDEDIICSTPIGNLSHA 231 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 537 ILSSGDMLLRTAGVCMETLHVFGDHLSKDIK 629 +L SG ++ RT VC LHVF S +K Sbjct: 138 VLDSG-LVNRTVPVCAPKLHVFDLKTSNHLK 167 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 492 AHTSNNSATVIVGRAILSSGDMLL 563 ++TSN S TVI+ + SS D+ L Sbjct: 91 SNTSNTSKTVILSNKLESSDDISL 114 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.0 bits (47), Expect = 2.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 492 AHTSNNSATVIVGRAILSSGDMLL 563 ++TSN S T+I+ + SS D+ L Sbjct: 91 SNTSNTSKTIILSNKLESSDDISL 114 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 492 AHTSNNSATVIVGRAILSSGDMLL 563 ++TSN S TVI+ + SS D+ L Sbjct: 91 SNTSNTSKTVILSDKLESSDDISL 114 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 492 AHTSNNSATVIVGRAILSSGDMLL 563 ++TSN S TVI+ + SS D+ L Sbjct: 91 SNTSNTSKTVILSDKLESSDDISL 114 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 492 AHTSNNSATVIVGRAILSSGDMLL 563 ++TSN S TVI+ + SS D+ L Sbjct: 91 SNTSNTSKTVILSDKLESSDDISL 114 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 498 TSNNSATVIVGRAILSSGDMLL 563 TSN S TVI+ + SS D+ L Sbjct: 93 TSNTSKTVILSNKLESSDDISL 114 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 492 AHTSNNSATVIVGRAILSSGDMLL 563 ++TSN S TVI+ + SS D+ L Sbjct: 91 SNTSNTSKTVILSDKLESSDDISL 114 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 352 GACQSAHTVGTNPSATSIIIGTPSITY 272 G C++ T ++P+A I GT Y Sbjct: 112 GGCRNFSTCSSHPTAAFISYGTLFFIY 138 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 352 GACQSAHTVGTNPSATSIIIGTPSITY 272 G C++ T ++P+A I GT Y Sbjct: 111 GGCRNFSTCSSHPTAAFISYGTLFFIY 137 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 7.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 492 AHTSNNSATVIVGRAILSSGDMLL 563 ++TSN S TVI+ + SS D+ L Sbjct: 91 SNTSNISKTVILSDKLESSDDISL 114 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 Query: 463 GKPVPPAGSSTPGRYRGAPP 404 G P P+ PG GAPP Sbjct: 37 GSPPNPSQGPPPGGPPGAPP 56 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,834 Number of Sequences: 438 Number of extensions: 4571 Number of successful extensions: 18 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -