BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11n22 (639 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 0.93 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 0.93 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.6 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 6.6 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.2 bits (50), Expect = 0.93 Identities = 11/49 (22%), Positives = 25/49 (51%) Frame = +1 Query: 103 GFKMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 G K K+P++A++L++ R+K+ + + I + G W ++ Sbjct: 472 GEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHAL 520 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.2 bits (50), Expect = 0.93 Identities = 11/49 (22%), Positives = 25/49 (51%) Frame = +1 Query: 103 GFKMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 G K K+P++A++L++ R+K+ + + I + G W ++ Sbjct: 364 GEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHAL 412 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 295 QYIVDLESFNANGGGPV 345 QY V +++FN G GP+ Sbjct: 1071 QYSVVVQAFNKVGAGPL 1087 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -3 Query: 625 TFYYELSNKKVYYLNLSNKSQK 560 +FY E ++ Y+L +SN + K Sbjct: 86 SFYLEATDDFAYFLEVSNNNFK 107 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,960 Number of Sequences: 336 Number of extensions: 2293 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -