BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11n22 (639 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 84 1e-16 SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) 49 3e-06 SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 46 2e-05 SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 42 3e-04 SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) 41 7e-04 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 41 7e-04 SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 41 0.001 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 41 0.001 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 40 0.001 SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) 40 0.001 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 40 0.002 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) 38 0.007 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 37 0.016 SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) 35 0.049 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.064 SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) 34 0.085 SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) 34 0.11 SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) 33 0.20 SB_18120| Best HMM Match : Colipase_C (HMM E-Value=0.87) 32 0.34 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) 30 1.4 SB_19426| Best HMM Match : Calx-beta (HMM E-Value=3e-06) 27 9.7 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 83.8 bits (198), Expect = 1e-16 Identities = 34/74 (45%), Positives = 50/74 (67%) Frame = +1 Query: 109 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWXXXXXXX 288 K + PKR MSAY+LWLN R +IKD NPG+ VTE++K AGE+W+++ DKS+W Sbjct: 537 KDPNAPKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKAAIE 596 Query: 289 XXQYIVDLESFNAN 330 +Y+ ++ +N N Sbjct: 597 KQKYVQRMKEYNEN 610 >SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) Length = 398 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/62 (35%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Frame = +1 Query: 85 IKIHI*GFKMTDKP--KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDK 258 + + + G K T KP KRPM+A+++W +AR K+ D P L E++K G++W+ + D Sbjct: 50 LPVRVNGIK-TQKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWKLLNDS 108 Query: 259 SE 264 + Sbjct: 109 EK 110 >SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 46.8 bits (106), Expect = 1e-05 Identities = 17/49 (34%), Positives = 32/49 (65%) Frame = +1 Query: 118 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 264 D+ KRPM+A+++W R K+ DNP + +EI+K+ G W+ + ++ + Sbjct: 787 DRVKRPMNAFMVWSRERRRKMAQDNPKMHNSEISKRLGSEWKLLSEQEK 835 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/49 (36%), Positives = 30/49 (61%) Frame = +1 Query: 109 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYD 255 K + KRPM+A+++W R KI +NP + +EI+K+ G W+ + D Sbjct: 322 KPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLAD 370 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/49 (36%), Positives = 30/49 (61%) Frame = +1 Query: 109 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYD 255 K + KRPM+A+++W R KI +NP + +EI+K+ G W+ + D Sbjct: 5 KPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLAD 53 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +1 Query: 109 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWXXXXX 282 K +KPKR +SAY ++N R +K DNP ++K GE+W M DK+++ Sbjct: 97 KDPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQYQDMAK 156 Query: 283 XXXXQYIVDLESF 321 +Y ++++F Sbjct: 157 KDKVRYESEMKAF 169 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/52 (26%), Positives = 28/52 (53%) Frame = +1 Query: 109 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 264 K +KPK SAY +L R K++ + + + +K + E W++M ++ + Sbjct: 7 KDPNKPKGAKSAYNFFLQDQREKLQREEGKFSLADFSKVSAEKWKNMSEEEK 58 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 45.2 bits (102), Expect = 5e-05 Identities = 17/47 (36%), Positives = 30/47 (63%) Frame = +1 Query: 109 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 K K KRPM+++++W SAR K+ + P + E++K G++WR + Sbjct: 106 KKDPKVKRPMNSFMVWAQSARRKLAEQYPHVHNAELSKMLGKLWRML 152 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 44.4 bits (100), Expect = 8e-05 Identities = 17/45 (37%), Positives = 29/45 (64%) Frame = +1 Query: 115 TDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 T++ KRPM+A+++W R ++ D NP L E++K G WR++ Sbjct: 363 TERIKRPMNAFMVWAQVERRRLADANPELHNAELSKMLGLTWRAL 407 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 42.3 bits (95), Expect = 3e-04 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +1 Query: 127 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 264 KRPM+++++W R K ++NP L EI+K G+ W + K + Sbjct: 95 KRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTKDK 140 >SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.9 bits (94), Expect = 4e-04 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +1 Query: 109 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 K D KRPM+AY++W R +I ++ P + +EI+K+ G W S+ Sbjct: 3 KPGDHIKRPMNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSL 49 >SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) Length = 245 Score = 41.1 bits (92), Expect = 7e-04 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +1 Query: 118 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 D KRP++++++W R + +NP ++ EI+K G+ WR M Sbjct: 8 DHVKRPLNSFMVWAKEKRRAMNRENPKMRNAEISKILGDEWRKM 51 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 41.1 bits (92), Expect = 7e-04 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 109 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 K + PK P++ Y+ +LN R K++ +NP L E+ + G +W + Sbjct: 172 KDVNAPKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQL 218 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 40.7 bits (91), Expect = 0.001 Identities = 14/46 (30%), Positives = 30/46 (65%) Frame = +1 Query: 127 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 264 KRPM+A+++W R K+ +++P + EI+K+ G+ W+ + + + Sbjct: 46 KRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLSESEK 91 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +1 Query: 127 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 KRPM+A+++W + R ++ +NP L ++I+K G WR + Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +1 Query: 127 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 KRPM+A+++W + R ++ +NP L ++I+K G WR + Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 40.3 bits (90), Expect = 0.001 Identities = 15/52 (28%), Positives = 32/52 (61%) Frame = +1 Query: 109 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 264 K+ +P +P+SAY ++ ++ I+ NP + EIAK G++W ++ ++ + Sbjct: 920 KIEGEPPKPLSAYQIFFKETQAAIRLQNPSAQFGEIAKIVGQMWENLPEEQK 971 >SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) Length = 245 Score = 40.3 bits (90), Expect = 0.001 Identities = 15/50 (30%), Positives = 32/50 (64%) Frame = +1 Query: 115 TDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 264 ++K KRP++A++LW R I ++NP + +I++K G W+ + ++ + Sbjct: 16 SEKIKRPLNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEEEK 65 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +1 Query: 118 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDK 258 ++PK P+++Y + R+K+ P LK TE+A K + WR M ++ Sbjct: 150 NQPKMPLTSYFRYCQKHRAKLAKKYPNLKSTELAAKLSKKWRKMSEE 196 Score = 36.3 bits (80), Expect = 0.021 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +1 Query: 133 PMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 264 P+SA+ LW N AR + NP + ++ KK W+ + +K + Sbjct: 230 PLSAFELWANQARKDLLVSNPDISAKKLKKKLKRKWKEIDEKGK 273 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 5/73 (6%) Frame = +1 Query: 118 DKPKRPMSAYLLW---LNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWXXXXX 282 +KPK P++ Y+ + LNS R +K +P L EI K G+ W S+ +K ++ Sbjct: 192 NKPKAPVTGYVHYVRFLNSRRESVKHQHPHLTFPEITKMLGQEWNSLLPEEKQKFLDEAE 251 Query: 283 XXXXQYIVDLESF 321 +Y+ +L ++ Sbjct: 252 EDKKRYVEELRAY 264 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +1 Query: 121 KPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 264 K KRPM+A+++W RS I P EI+ + GEIW + + + Sbjct: 100 KVKRPMNAFMIWARLHRSTIAKRYPQANNAEISIRLGEIWNDLSSEQQ 147 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 39.1 bits (87), Expect = 0.003 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 127 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 KRPM+ +++W R +I +NPG+ ++K G W+ + Sbjct: 9 KRPMNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKL 49 >SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) Length = 324 Score = 37.9 bits (84), Expect = 0.007 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = +1 Query: 124 PKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYD 255 P++P+ Y+ + ++K+ NP K+ +I K G++WR + D Sbjct: 28 PEKPLMPYMRYSRKVWDQVKNQNPDFKLWDIGKIIGQMWRDLDD 71 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 36.7 bits (81), Expect = 0.016 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +1 Query: 109 KMTDKPKRPMSAYLLWLNSARSKI--KDDNPGLKVTEIAKKAGEIWRSMYDKSE 264 K DKPKRP +AY L+L + R ++ K G K+ + AGE WR M D+ + Sbjct: 572 KDPDKPKRPPTAYFLFLAAFRKEMAGKALEDGKKIPSL---AGERWREMSDEDK 622 Score = 33.1 bits (72), Expect = 0.20 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +1 Query: 127 KRPMSAYLLWLNSARSKIK-----DDNPGLKVTEIAKKAGEIWRSMYDKSE 264 KR SAY+ + + R+K+K P K E+AK AGE W+ + D+ + Sbjct: 497 KRASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLNDEQK 547 >SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) Length = 145 Score = 35.1 bits (77), Expect = 0.049 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Frame = +1 Query: 127 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWR--SMYDKSEWXXXXXXXXXQY 300 KR S YLL+ + R I+ ++P EI++ GE WR S K+E+ Q Sbjct: 36 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYENKAQMQLSQ- 94 Query: 301 IVDLESFNANGGGP 342 ++ ES + G GP Sbjct: 95 -LETESLSRAGHGP 107 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 34.7 bits (76), Expect = 0.064 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +1 Query: 127 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDK 258 KRPM+A+++W R + P + +EI+K G W++M D+ Sbjct: 10 KRPMNAFMVWSKERRRIKSQECPRMHNSEISKILGCEWKAMKDE 53 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 34.7 bits (76), Expect = 0.064 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 121 KPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 K KRP A+ + K+K++NP LK EI K + W ++ Sbjct: 305 KHKRPTPAFFRFRQDYADKVKEENPHLKDAEIRKHLSDQWANL 347 Score = 31.5 bits (68), Expect = 0.60 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = +1 Query: 124 PKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 P++P + L++ +KIK +N G+ +I ++ G WR++ Sbjct: 374 PRKPPRHFSLFMRENFAKIKAENQGMSNPDIMRELGAKWRNL 415 >SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) Length = 201 Score = 34.3 bits (75), Expect = 0.085 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +1 Query: 127 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 264 KRPM+A+++W + R K+ P + EI+K G W + ++ + Sbjct: 10 KRPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEEEK 55 >SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) Length = 406 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/52 (25%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +1 Query: 118 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEW 267 D+ + + + LWL R +I+++NP + ++ K A + W+ + +K W Sbjct: 327 DRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGLDSVEKKVW 378 >SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) Length = 200 Score = 33.1 bits (72), Expect = 0.20 Identities = 11/44 (25%), Positives = 25/44 (56%) Frame = +1 Query: 118 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 D+ + + + LWL R +I+++NP + ++ K A + W+ + Sbjct: 34 DRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGL 77 >SB_18120| Best HMM Match : Colipase_C (HMM E-Value=0.87) Length = 363 Score = 32.3 bits (70), Expect = 0.34 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = +3 Query: 336 RSRREKKENPKTREESETGAKNKESETGRRG 428 +SRREK+ NP+ R+++ G + K+S R+G Sbjct: 284 QSRREKRSNPEERDKAIPGRETKQSRGERQG 314 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 32.3 bits (70), Expect = 0.34 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 127 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRS 246 KR S YLL+ + R I+ ++P EI++ GE WR+ Sbjct: 1269 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRN 1308 >SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 31.9 bits (69), Expect = 0.45 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 327 KWRRSRR-EKKENPKTREESETGAKNKESETGRRG 428 KW R E+++ PKT EE E ++N GRRG Sbjct: 236 KWLHDRYVEEEQAPKTAEELEESSRNLRRNAGRRG 270 >SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 30.7 bits (66), Expect = 1.0 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 327 KWRRSRREKKENPKTREESETGAKNKESETGRRGR 431 K R+ +++KK+ K EE E +N+E E R+ R Sbjct: 15 KKRKKKKQKKQKKKKEEEEEEEEENEEEERRRKRR 49 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 333 RRSRREKKENPKTREESETGAKNKESE 413 R+ ++KKE + EE ET A N+E E Sbjct: 59 RKKEKKKKEEEEEEEEEETEAVNEEEE 85 >SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) Length = 271 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 127 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 249 K PM+A+++ R NPG+ +E +K G W+ + Sbjct: 10 KSPMNAFMVCSRGKRKHYASINPGMHNSEFSKSLGPEWKML 50 >SB_19426| Best HMM Match : Calx-beta (HMM E-Value=3e-06) Length = 631 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 212 SVTFNPGLSSFIFDLALFNH 153 SVTFNPG SS +F + + N+ Sbjct: 525 SVTFNPGQSSVVFTIDIANN 544 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,350,688 Number of Sequences: 59808 Number of extensions: 252510 Number of successful extensions: 974 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -