BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11n18 (689 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protei... 27 1.9 SPAC8C9.04 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 26 5.9 >SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1462 Score = 27.5 bits (58), Expect = 1.9 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 335 NLTSKYPRSVSCESRRDVLEPAGEGSSNRAAQASSISSWDGLV 207 NL + S S S+ D+L P G+G + S I S +GL+ Sbjct: 848 NLPTLNTSSSSNSSQTDLLVPHGKGETKETEMQSPIESKEGLL 890 >SPAC8C9.04 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 647 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 196 GPVPTRPSQLEMEEACAALFDEPSPAGSSTSRRDSQLTD 312 G T+P+ + E AA +P+PA +T+ +++ D Sbjct: 579 GSATTKPTPVSATEEHAAGTTKPAPAAGATATAENETAD 617 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,045,054 Number of Sequences: 5004 Number of extensions: 30895 Number of successful extensions: 47 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -