BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11n18 (689 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L08582-1|AAF66141.1| 355|Homo sapiens lysosomal-associated memb... 31 5.1 J04182-1|AAA60382.1| 416|Homo sapiens lysosomal membrane glycop... 31 5.1 J03263-1|AAA59524.1| 385|Homo sapiens LAMP1 protein. 31 5.1 BC093044-1|AAH93044.1| 417|Homo sapiens lysosomal-associated me... 31 5.1 BC021288-1|AAH21288.1| 417|Homo sapiens lysosomal-associated me... 31 5.1 BC007845-1|AAH07845.2| 248|Homo sapiens LAMP1 protein protein. 31 5.1 BC006345-1|AAH06345.2| 308|Homo sapiens LAMP1 protein protein. 31 5.1 AL136221-7|CAI13797.1| 417|Homo sapiens lysosomal-associated me... 31 5.1 AB209319-1|BAD92556.1| 392|Homo sapiens LAMP1 protein variant p... 31 5.1 AB029018-1|BAA83047.1| 1098|Homo sapiens KIAA1095 protein protein. 30 8.9 >L08582-1|AAF66141.1| 355|Homo sapiens lysosomal-associated membrane glycoprotein-1 protein. Length = 355 Score = 30.7 bits (66), Expect = 5.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 188 RGSVRCRRDRPSSRWKRPAPP 250 RG RC +DRPS PAPP Sbjct: 125 RGETRCEQDRPSPTTAPPAPP 145 >J04182-1|AAA60382.1| 416|Homo sapiens lysosomal membrane glycoprotein-1 protein. Length = 416 Score = 30.7 bits (66), Expect = 5.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 188 RGSVRCRRDRPSSRWKRPAPP 250 RG RC +DRPS PAPP Sbjct: 185 RGETRCEQDRPSPTTAPPAPP 205 >J03263-1|AAA59524.1| 385|Homo sapiens LAMP1 protein. Length = 385 Score = 30.7 bits (66), Expect = 5.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 188 RGSVRCRRDRPSSRWKRPAPP 250 RG RC +DRPS PAPP Sbjct: 154 RGETRCEQDRPSPTTAPPAPP 174 >BC093044-1|AAH93044.1| 417|Homo sapiens lysosomal-associated membrane protein 1 protein. Length = 417 Score = 30.7 bits (66), Expect = 5.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 188 RGSVRCRRDRPSSRWKRPAPP 250 RG RC +DRPS PAPP Sbjct: 186 RGETRCEQDRPSPTTAPPAPP 206 >BC021288-1|AAH21288.1| 417|Homo sapiens lysosomal-associated membrane protein 1 protein. Length = 417 Score = 30.7 bits (66), Expect = 5.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 188 RGSVRCRRDRPSSRWKRPAPP 250 RG RC +DRPS PAPP Sbjct: 186 RGETRCEQDRPSPTTAPPAPP 206 >BC007845-1|AAH07845.2| 248|Homo sapiens LAMP1 protein protein. Length = 248 Score = 30.7 bits (66), Expect = 5.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 188 RGSVRCRRDRPSSRWKRPAPP 250 RG RC +DRPS PAPP Sbjct: 17 RGETRCEQDRPSPTTAPPAPP 37 >BC006345-1|AAH06345.2| 308|Homo sapiens LAMP1 protein protein. Length = 308 Score = 30.7 bits (66), Expect = 5.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 188 RGSVRCRRDRPSSRWKRPAPP 250 RG RC +DRPS PAPP Sbjct: 77 RGETRCEQDRPSPTTAPPAPP 97 >AL136221-7|CAI13797.1| 417|Homo sapiens lysosomal-associated membrane protein 1 protein. Length = 417 Score = 30.7 bits (66), Expect = 5.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 188 RGSVRCRRDRPSSRWKRPAPP 250 RG RC +DRPS PAPP Sbjct: 186 RGETRCEQDRPSPTTAPPAPP 206 >AB209319-1|BAD92556.1| 392|Homo sapiens LAMP1 protein variant protein. Length = 392 Score = 30.7 bits (66), Expect = 5.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 188 RGSVRCRRDRPSSRWKRPAPP 250 RG RC +DRPS PAPP Sbjct: 175 RGETRCEQDRPSPTTAPPAPP 195 >AB029018-1|BAA83047.1| 1098|Homo sapiens KIAA1095 protein protein. Length = 1098 Score = 29.9 bits (64), Expect = 8.9 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -1 Query: 329 TSKYPRSVSCESRRDVLEPAGEGSSNRAAQASSISSWDGLVGTGPTPAP 183 +S Y SC S LE + + S RAA+ S S +G VGT P Sbjct: 787 SSAYNTGESCRSTPLTLEISPDNSLRRAAEGISCPSSEGAVGTTEAYGP 835 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,705,926 Number of Sequences: 237096 Number of extensions: 1239430 Number of successful extensions: 2562 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2562 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7895240574 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -