BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11n17 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 25 0.90 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 23 2.1 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 23 2.1 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 8.4 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.90 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 510 NYRSCFCTSSRIVYSNH*VLEQMP 581 NY+ +C + R +Y N +EQ+P Sbjct: 95 NYKKLYCNNYRKLYYNINYIEQIP 118 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 510 NYRSCFCTSSRIVYSNH*VLEQMP 581 NY+ +C + + +Y N +EQ+P Sbjct: 95 NYKKLYCNNYKKLYYNINYIEQIP 118 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 510 NYRSCFCTSSRIVYSNH*VLEQMP 581 NY+ +C + + +Y N +EQ+P Sbjct: 95 NYKKLYCNNYKKLYYNINYIEQIP 118 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +2 Query: 317 LMIL*NWESLIAFGGFTILSW*HVHQHLKKKIFSTSNLFWIK 442 LM +W S++ + L W H K F N ++K Sbjct: 79 LMEFDDWTSVMELHSWMTLMWTDSHLSWKPSDFDGINYIYVK 120 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,409 Number of Sequences: 438 Number of extensions: 4392 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -