BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11n15 (734 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0797 - 23230441-23230757,23230922-23231069,23231352-232325... 31 1.3 10_08_0253 - 16196275-16196307,16196425-16196550,16196643-161967... 29 3.8 05_06_0060 - 25266735-25267210,25267323-25267569,25267650-252683... 29 5.1 04_04_1675 - 35280705-35281493,35281544-35281795 29 5.1 01_05_0573 + 23359968-23361044,23361112-23361255,23361458-23361841 28 8.8 >12_02_0797 - 23230441-23230757,23230922-23231069,23231352-23232562, 23232639-23232894,23234073-23234309 Length = 722 Score = 30.7 bits (66), Expect = 1.3 Identities = 21/66 (31%), Positives = 30/66 (45%) Frame = +3 Query: 264 SRTLGGPVPDMNDHEAMQRFFLQQIQXXXXXXXXXXXXXXVEHLGQAVAVCGQTEQLLSV 443 S+T G VP N EA+ L I +EHL A+++CGQT L Sbjct: 262 SQTEGSYVPKNNLEEAI--LLLMIILKKWYLGKTHWDPSVMEHLTFALSLCGQTSVLAKH 319 Query: 444 LQQTMP 461 L++ +P Sbjct: 320 LEEVLP 325 >10_08_0253 - 16196275-16196307,16196425-16196550,16196643-16196741, 16196822-16197001,16197090-16197371,16197471-16199141, 16199257-16199463,16199566-16199700,16199792-16200082, 16200403-16200621,16200876-16201034,16201120-16201181, 16201257-16201383,16201460-16201693,16201777-16202003, 16202163-16202257,16202341-16202468,16202574-16202594, 16202765-16202921,16203007-16203075,16203228-16203341, 16203415-16203491,16203576-16203688,16204432-16204507, 16204592-16204756,16204825-16204952,16205049-16205130, 16205426-16205548,16205633-16205860,16205933-16206034, 16206144-16206341,16206581-16206760,16206868-16207020, 16207690-16207797,16208201-16208355,16208786-16208912, 16209825-16209914,16209986-16210127,16210303-16210379, 16210467-16210582,16210638-16210773,16211130-16211198, 16211279-16211361,16211655-16211720,16211788-16211974, 16212054-16213547,16213635-16214165,16214234-16214363, 16214407-16215878,16216359-16216364,16216750-16217055, 16217364-16217468,16217577-16217772,16217862-16217929, 16218853-16220631,16221026-16221151,16221604-16221780, 16221997-16222128,16223461-16223498,16223710-16223788, 16224175-16224284,16224787-16224935,16225027-16225197, 16225281-16225552,16226355-16226442,16227942-16228369 Length = 5157 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = -1 Query: 509 F*NFWQFLKKQMEDWSWHSLLKYTKQLFS---LSTNSHSLPEMFDSSFKITCSQQL 351 F N+ LKK+ + WHS+L+ +++ + + +H +P + +TCS L Sbjct: 2448 FENYGNILKKESDHPIWHSILECYREIVAYHKIDVVAHPIPLLSMRLLDMTCSVTL 2503 >05_06_0060 - 25266735-25267210,25267323-25267569,25267650-25268345, 25268457-25268709,25268786-25269261,25270760-25270909 Length = 765 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = -1 Query: 656 CLQKTDKNKT----KINHYGHHVLLSSLQIHNFLFDIFFLHYVAP 534 C Q+ K K+ KI G++VLLS + ++ F + FLH + P Sbjct: 550 CFQQVTKVKSRIVLKILRLGYNVLLSDVDVYWFHNPVSFLHSLGP 594 >04_04_1675 - 35280705-35281493,35281544-35281795 Length = 346 Score = 28.7 bits (61), Expect = 5.1 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +3 Query: 171 CVYFDQQ-RRKDPLFKKKLRERRLNAQQNASRSRTLGGPVPDMNDH 305 C +FD + RR+D F KKL LN ++ +R + L PD D+ Sbjct: 214 CAFFDDRARRQDDTFSKKL---ALNCTKDPNRLQNLDVITPDAFDN 256 >01_05_0573 + 23359968-23361044,23361112-23361255,23361458-23361841 Length = 534 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 Query: 289 GTGPPRVRDLEAFCCAFSLRSLNFFLNSGSLRLCWSKY 176 G G P +R+L +C A R L+F L + + C Y Sbjct: 224 GAGFPHLRELGLYCVAMEDRDLDFVLANSPVLECLGIY 261 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,765,850 Number of Sequences: 37544 Number of extensions: 369312 Number of successful extensions: 933 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -