BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11n06 (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 26 0.31 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 26 0.31 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 0.53 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.9 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.8 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 23 3.8 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.7 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.7 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 26.2 bits (55), Expect = 0.31 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 309 KESDHIQAVAAGEFHSLYLSNSGHL-YSCGNND 404 KE HI V G S + +GHL Y CG D Sbjct: 3 KEKIHINIVVIGHVDSGKSTTTGHLIYKCGGID 35 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 26.2 bits (55), Expect = 0.31 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 309 KESDHIQAVAAGEFHSLYLSNSGHL-YSCGNND 404 KE HI V G S + +GHL Y CG D Sbjct: 3 KEKIHINIVVIGHVDSGKSTTTGHLIYKCGGID 35 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 25.4 bits (53), Expect = 0.53 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -1 Query: 593 SAKVIAKLPHTVRAPTE 543 +A +++KLP TVR PT+ Sbjct: 527 AANIMSKLPKTVRTPTD 543 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 318 DHIQAVAAGEFHSLYLSNSGHLYSCGN 398 D IQA A+ + + + + GH Y CG+ Sbjct: 1049 DLIQAEAS-QIYDMLVYEGGHFYVCGD 1074 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 612 KFVKGLATKNVIQVACGAYHSVALTN 689 + +KG A ++ +V+C HS LTN Sbjct: 410 RILKGPANPDIFRVSCATEHS-QLTN 434 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 612 KFVKGLATKNVIQVACGAYHSVALTN 689 + +KG A ++ +V+C HS LTN Sbjct: 116 RILKGPANPDIFRVSCATEHS-QLTN 140 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 148 QSEGMEVNLYIYSSPQNS 95 + EGM L++Y SP +S Sbjct: 610 KKEGMPFQLFLYVSPVSS 627 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 148 QSEGMEVNLYIYSSPQNS 95 + EGM L++Y SP +S Sbjct: 610 KKEGMPFQLFLYVSPVSS 627 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,789 Number of Sequences: 438 Number of extensions: 4089 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -