BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11m19 (567 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 6.5 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 6.5 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 6.5 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 6.5 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -3 Query: 550 ILRSFRMQSAKLSC*DRVQSDFMIK 476 ILR+FR++S R+Q+D ++K Sbjct: 505 ILRNFRVRSDVKESEFRLQADIILK 529 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.4 bits (43), Expect = 6.5 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 265 GLNAGVVSFKELFG*RVSNDMELLYPKGL*SNAVQVAFLIKP 140 G N VS KEL V+ D + PKG QV L P Sbjct: 309 GFNVKNVSVKELRRGYVAGDSKNNPPKGAADFTAQVIVLNHP 350 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/31 (22%), Positives = 17/31 (54%) Frame = +3 Query: 423 IRQRMLELYDKKLTKEGYLIIKSDCTRSQQL 515 I+ ++YD + + G+ + DCT ++ + Sbjct: 1051 IQAEASQIYDMLVYEGGHFYVCGDCTMAEDV 1081 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,997 Number of Sequences: 438 Number of extensions: 3157 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -