BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11m13 (671 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0561 - 24984960-24985205,24985283-24985354,24985906-249859... 31 1.1 01_06_0133 - 26793335-26793380,26793696-26793907,26794009-267941... 29 2.6 01_07_0353 + 42962769-42962972,42963062-42963138,42963571-429638... 29 3.4 08_01_0361 + 3165516-3165564,3166316-3166386,3166481-3166562,316... 28 5.9 07_03_0775 - 21413522-21413797,21414016-21414178,21414274-214143... 28 7.8 >11_06_0561 - 24984960-24985205,24985283-24985354,24985906-24985977, 24986612-24986782,24987464-24987653,24987733-24987976, 24988162-24988474,24988687-24989517,24989628-24989672, 24989677-24989790,24989877-24990371,24990627-24990824, 24990902-24991357 Length = 1148 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/71 (25%), Positives = 31/71 (43%) Frame = +3 Query: 315 VKKSRFKSKQRTQETFSRVSKLKAENQVLEEKVKTLSKQLQFLKDLFFAQAKKDTTELEG 494 VK K F R+ +EN+ L ++ QF+ + F+ KD + ++ Sbjct: 710 VKSEVCKEAGYASSLFQRLMHSSSENKRLTKQYMMDPSISQFVSENFYEGRLKDDSTVKS 769 Query: 495 IDLNKLFEDLP 527 D NKL ++ P Sbjct: 770 DDYNKLLKEFP 780 >01_06_0133 - 26793335-26793380,26793696-26793907,26794009-26794134, 26794258-26794335,26794857-26795014,26795230-26795278, 26795369-26795414,26795527-26795654,26796154-26796237, 26796317-26796409,26796505-26796549,26796792-26796851 Length = 374 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +3 Query: 309 EAVKKSRFKSKQRTQETFSRVSKLKAENQVLEEKVKTLSKQLQFLK 446 E+ ++SR + + T+E +V L AEN L ++ L++ + L+ Sbjct: 237 ESARRSRLRKQAETEELARKVELLTAENTSLRREISRLTESSKKLR 282 >01_07_0353 + 42962769-42962972,42963062-42963138,42963571-42963817, 42963907-42964476,42964998-42965171,42965514-42965640, 42965719-42965828,42966707-42966907,42966999-42967966, 42968110-42968358,42968760-42969105 Length = 1090 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = -3 Query: 543 LCPYRLVSLQRACLSRYLPIRWCLSLLEQKTSLSGTEVVLIKFLLSPRAL 394 LC +L S+ +CL L + + S + + G VL++ +LS +A+ Sbjct: 444 LCAQKLPSITTSCLGGLLALVFYESSISDSANFDGEAAVLVQAILSIKAI 493 >08_01_0361 + 3165516-3165564,3166316-3166386,3166481-3166562, 3166677-3166792,3166892-3167053,3167158-3167202, 3168097-3168174,3168632-3168742 Length = 237 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 318 KKSRFKSKQRTQETFSRVSKLKAENQVLEEKVKTLSKQLQFLK 446 + S +K+R E S +SKL EN+V ++ + L +L+ L+ Sbjct: 163 RSSAEPTKERPTEPSSMISKLNEENRVAIQQNQKLRHELELLR 205 >07_03_0775 - 21413522-21413797,21414016-21414178,21414274-21414351, 21415983-21416176 Length = 236 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 354 ETFSRVSKLKAENQVLEEKVKTLSKQLQFLKD 449 E S KLK N+ L+EK+K L + L+D Sbjct: 122 ELRSEAQKLKESNESLQEKIKELKAEKNELRD 153 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,968,750 Number of Sequences: 37544 Number of extensions: 207548 Number of successful extensions: 455 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -