BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11m13 (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 26 1.2 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 3.8 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 5.0 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 25.8 bits (54), Expect = 1.2 Identities = 14/56 (25%), Positives = 30/56 (53%) Frame = +3 Query: 333 KSKQRTQETFSRVSKLKAENQVLEEKVKTLSKQLQFLKDLFFAQAKKDTTELEGID 500 K +R QE ++ + + + L++++ T +QLQ L + F ++TT E ++ Sbjct: 734 KEDERLQEMTRKLHQRQQHMKKLQQELLTNEQQLQQLAGVVFEGETEETTLREELE 789 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 3.8 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -3 Query: 555 TIYHLCPYRLVSLQRACLSRYLPIRWCLSLLEQ-KTSLSGTEVVL 424 T+Y L P R + QRA +R R L L+ Q + +S +VVL Sbjct: 557 TVYFLAPDRFLGDQRASYNRLFKFR--LQLVGQPRVEVSPYDVVL 599 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 211 IFTICLLLKEGSVVLAMLMMRMMITEKDETGI 306 +F ICLLL + A+ M + KD++G+ Sbjct: 1752 LFNICLLLFLVMFIFAIFGMSFFMHVKDKSGL 1783 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 542,999 Number of Sequences: 2352 Number of extensions: 8996 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -