BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11m12 (640 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 24 1.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 24 1.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.4 AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. 22 5.8 AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. 22 5.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 7.6 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 194 DLK*YQSHHYAENH*ICVENS 132 DL YQSHH+ +H + + S Sbjct: 66 DLPIYQSHHHLHHHQVLYQQS 86 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/40 (27%), Positives = 15/40 (37%) Frame = +2 Query: 395 TLIYYKGTGYESYKFWEDQLIDFLSVYKKKGQTAGTGQNI 514 T+ + G Y+ W QLI + G G NI Sbjct: 171 TIFPQRTDGKHDYRVWNHQLISYAGYKNPDGTIIGDPANI 210 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 265 CNLHGDIPATV 297 C +HGD P TV Sbjct: 829 CEVHGDTPVTV 839 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 265 CNLHGDIPATV 297 C +HGD P TV Sbjct: 825 CEVHGDTPVTV 835 >AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 443 EDQLIDFLSVYKKKGQTAGTGQNI 514 E LI + +KK+GQT QN+ Sbjct: 107 EASLIGLVERHKKRGQTKEEFQNL 130 >AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 443 EDQLIDFLSVYKKKGQTAGTGQNI 514 E LI + +KK+GQT QN+ Sbjct: 107 EASLIGLVERHKKRGQTKEEFQNL 130 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -1 Query: 283 CHHADCKQSYECCIEYRIEDQD 218 C +D ++ Y+C + Y D+D Sbjct: 1057 CFDSDRERLYDCYVCYSPNDED 1078 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,660 Number of Sequences: 438 Number of extensions: 4939 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -