BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11m10 (658 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 25 2.8 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 23 6.4 AJ970245-1|CAI96717.1| 134|Anopheles gambiae putative reverse t... 23 8.5 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 24.6 bits (51), Expect = 2.8 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 317 QWEKVKLSRNFEKAIHQINENLLYWPAFIKAKCKQRFVKITQ 442 Q E+ K FE+ I +IN NL + + +K QR+ + Q Sbjct: 812 QQERAKKRAEFEQQIDRINNNLEFERSKDTSKNVQRWERAVQ 853 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 23.4 bits (48), Expect = 6.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 268 YLFVYEDS*ENNVPSKTMGESETVQ 342 Y V ++S NN KT+G+ ETV+ Sbjct: 315 YAKVVQNSIGNNGTVKTLGQMETVE 339 >AJ970245-1|CAI96717.1| 134|Anopheles gambiae putative reverse transcriptase protein. Length = 134 Score = 23.0 bits (47), Expect = 8.5 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -2 Query: 387 YNKFSFI*CIA--FSKFLDSFTFSHCFAGNIILSAVFIYK 274 Y S + C+ F K L+S H F NII + F ++ Sbjct: 2 YRPISLLSCLGKIFEKLLESRMALHTFNNNIIPKSQFGFR 41 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,180 Number of Sequences: 2352 Number of extensions: 13704 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -