BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11m10 (658 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 25 0.48 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 25 0.48 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 3.4 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 22 4.5 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 4.5 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 25.4 bits (53), Expect = 0.48 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -3 Query: 632 ESCRCHCKCLFLISLTIVFL 573 E CRCH +C+ ++L ++ L Sbjct: 477 EPCRCHARCIARLALDMMDL 496 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 25.4 bits (53), Expect = 0.48 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -3 Query: 632 ESCRCHCKCLFLISLTIVFL 573 E CRCH +C+ ++L ++ L Sbjct: 477 EPCRCHARCIARLALDMMDL 496 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +2 Query: 74 FTLIVKMQHDDVVWAIINKTHCSHKVT 154 + +I+ +HDD I+N+ H +T Sbjct: 467 YVIILDDEHDDAFIGIVNQFHILQFIT 493 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +2 Query: 332 KLSRNFEKAIHQINENLLYWPAFIKAKCKQRFVKIT 439 K F+KA+ ++EN+ + ++K + K T Sbjct: 215 KFEEAFQKALRMVDENINGFDPYVKTPNDEELEKPT 250 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 156 VVTLCEQCVLFIMAHTTSSCCILTISVN 73 VV L + VLF M T S C+ + +N Sbjct: 299 VVPLLGKFVLFTMILDTFSICVTVVVLN 326 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,945 Number of Sequences: 438 Number of extensions: 3656 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -