BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11m08 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 23 6.8 AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical prote... 23 9.0 AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosens... 23 9.0 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = -1 Query: 315 SLSILYQVLHTNAQFRISLNLRYKKISSKIWSGMISAKAYF 193 ++ ++YQ Q++ N K + ++ WS + K YF Sbjct: 259 TVDMMYQWRELMDQYKQEHNTTTKVLMTEAWSSLDVVKTYF 299 >AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical protein protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 8/30 (26%), Positives = 19/30 (63%) Frame = +1 Query: 46 SSKAIILKFNH*PAVTIDLSKKVLNNYQNC 135 +++ + K+++ I SK++++NY NC Sbjct: 19 ANETYVTKYDNIDLEEIFSSKRLMDNYMNC 48 >AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosensory protein CSP3 protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 8/30 (26%), Positives = 19/30 (63%) Frame = +1 Query: 46 SSKAIILKFNH*PAVTIDLSKKVLNNYQNC 135 +++ + K+++ I SK++++NY NC Sbjct: 19 ANETYVTKYDNIDLEEIFSSKRLMDNYMNC 48 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,479 Number of Sequences: 2352 Number of extensions: 16196 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -