BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11m06 (649 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 5.9 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 7.8 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 5.9 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = +3 Query: 372 NSIAASTKMGKFKERYGNIRNNLSKVSIIS*LFVSNNTLINMIFSSGCR 518 NSI M + Y + N+ S IS + SNN + + CR Sbjct: 631 NSIMQRASMKENLNVYPEFQENVQLCSEISESYSSNNKTLCKCDAQNCR 679 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -2 Query: 303 IVSGICCLIIEMFFRRHK 250 I+ GI +IIE+ +++H+ Sbjct: 834 IIGGIGLIIIEVAYKKHQ 851 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,959 Number of Sequences: 438 Number of extensions: 3584 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -