BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11m04 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 25 0.98 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 25 0.98 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 24 1.7 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 24 1.7 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 24 1.7 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 23 3.9 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 23 3.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.1 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 24.6 bits (51), Expect = 0.98 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -3 Query: 582 NSMFRAGREQPGTKLEQVIKAKQLYESAFHPDSGELQNVFGRMSFQM 442 N +FR G P K E K LY + + GEL N +Q+ Sbjct: 6 NVIFRHGDRIPDEKNEMYPKDPYLYYDFYPLERGELTNSGKMREYQL 52 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 24.6 bits (51), Expect = 0.98 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -3 Query: 582 NSMFRAGREQPGTKLEQVIKAKQLYESAFHPDSGELQNVFGRMSFQM 442 N +FR G P K E K LY + + GEL N +Q+ Sbjct: 21 NVIFRHGDRIPDEKNEMYPKDPYLYYDFYPLERGELTNSGKMREYQL 67 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 440 GIWNDILPKTFCSSPLSGWN 499 G+W IL S PL+GWN Sbjct: 159 GVW--ILSGAISSPPLAGWN 176 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 440 GIWNDILPKTFCSSPLSGWN 499 G+W IL S PL+GWN Sbjct: 159 GVW--ILSGAISSPPLAGWN 176 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 440 GIWNDILPKTFCSSPLSGWN 499 G+W IL S PL+GWN Sbjct: 159 GVW--ILSGAISSPPLAGWN 176 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 196 CLFYLSSVIPVVKITIFTSNL 134 C+F + VIP++ I +F S L Sbjct: 223 CIFIWAYVIPLIFIILFYSRL 243 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 196 CLFYLSSVIPVVKITIFTSNL 134 C+F + VIP++ I +F S L Sbjct: 223 CIFIWAYVIPLIFIILFYSRL 243 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +3 Query: 252 NLLIYLMVTSENY*DIVSVSRQIHKCFMKT*EIFG 356 N Y + + + V + +HKCFM+ + G Sbjct: 536 NTFCYFRRNAATWKNAVRHNLSLHKCFMRVENVKG 570 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,429 Number of Sequences: 438 Number of extensions: 4438 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -