BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11m02 (613 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 3.5 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 4.7 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +1 Query: 439 DCPCHGSWAGSLAGGGNTGDDRE 507 DCP W G G GD E Sbjct: 7 DCPKRMKWEGGEEGSPEEGDKLE 29 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -3 Query: 371 GTSSLSYRQDRAGLFLVRSLDMLSVCQTQG 282 GT++L++ +D VR ++ ++CQ G Sbjct: 106 GTTALTFEEDPEPFGGVRDHNLTTLCQELG 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,587 Number of Sequences: 336 Number of extensions: 3471 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -