BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11m01 (471 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 25 1.0 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 25 1.0 Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein... 23 5.4 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 7.1 CR954257-7|CAJ14158.1| 284|Anopheles gambiae signal sequence re... 22 9.4 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 25.4 bits (53), Expect = 1.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 266 VNMLLDDVTEYESTPEG 316 VNM L+++T Y+ PEG Sbjct: 315 VNMTLNEITPYDKYPEG 331 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 25.4 bits (53), Expect = 1.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 266 VNMLLDDVTEYESTPEG 316 VNM L+++T Y+ PEG Sbjct: 315 VNMTLNEITPYDKYPEG 331 >Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein protein. Length = 401 Score = 23.0 bits (47), Expect = 5.4 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -2 Query: 443 LFRKSSHKITIHRMILQAFHHRAPTSLCYCHLIEFDPT 330 LF+ H+ +L+ H AP HL E PT Sbjct: 296 LFKAKGHRFAAIEQLLKWAHQYAPMRGGKAHLEEILPT 333 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.6 bits (46), Expect = 7.1 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 191 CICQQVPEAVTCLD 150 C+C V + V CLD Sbjct: 1880 CLCSSVMQIVACLD 1893 >CR954257-7|CAJ14158.1| 284|Anopheles gambiae signal sequence receptor protein. Length = 284 Score = 22.2 bits (45), Expect = 9.4 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 222 FFIMI*MREPMHLSTSSRGSNVFGFGNE 139 FF+++ + P L T + GS+ F F E Sbjct: 4 FFVLLLLALPAVLLTVNTGSSPFAFAAE 31 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,499 Number of Sequences: 2352 Number of extensions: 9691 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41245467 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -