BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11l19 (606 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0179 - 1412391-1412863,1412947-1413412,1413504-1414551,141... 30 1.6 >11_01_0179 - 1412391-1412863,1412947-1413412,1413504-1414551, 1414639-1414725,1416244-1416411,1416785-1416958, 1417662-1417720,1418132-1420154,1420549-1420647, 1420998-1421796,1422101-1422120,1422446-1422513 Length = 1827 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -2 Query: 131 TTTPETLVFFVKFATSKKVVLC-SQSNL*PKMAKECLNG 18 T T + FVK S LC Q NL P ECLNG Sbjct: 998 TLTTQMRAIFVKTLCSYSTGLCYEQRNLDPAFGPECLNG 1036 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,817,192 Number of Sequences: 37544 Number of extensions: 212224 Number of successful extensions: 386 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1442939384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -