BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11l19 (606 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g07450.1 68417.m01143 hypothetical protein includes At2g05890... 27 7.3 At2g05890.1 68415.m00638 hypothetical protein includes At2g05890... 27 9.6 >At4g07450.1 68417.m01143 hypothetical protein includes At2g05890, At4g07450, At3g30630, At3g43100, At2g09960, At3g30550, At1g39430, At2g10460, At4g03640, At5g35250 Length = 439 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 201 YCCNVNNILLYDLLNASTKKSRVNYNPRNPSFFCEICN 88 +CC +N + + + K V P+ P F+CEICN Sbjct: 228 FCCRAHNKKVVE--EEAIKLEDVKL-PQKPRFWCEICN 262 >At2g05890.1 68415.m00638 hypothetical protein includes At2g05890, At4g07450, At3g30630, At3g43100, At2g09960, At3g30550, At1g39430, At2g10460, At4g03640, At5g35250 Length = 456 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 201 YCCNVNNILLYDLLNASTKKSRVNYNPRNPSFFCEICN 88 +CC +N + + + K V P+ P F+CEICN Sbjct: 279 FCCRAHNKKV--VKEEAIKLEDVK-QPQKPRFWCEICN 313 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,344,763 Number of Sequences: 28952 Number of extensions: 200962 Number of successful extensions: 456 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -