BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11l16 (566 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00033-5|AAC48301.1| 152|Caenorhabditis elegans Ribosomal prote... 189 1e-48 Z49911-5|CAA90128.1| 431|Caenorhabditis elegans Hypothetical pr... 27 7.1 AC024785-5|AAF60596.1| 577|Caenorhabditis elegans C-type lectin... 27 9.4 >U00033-5|AAC48301.1| 152|Caenorhabditis elegans Ribosomal protein, small subunitprotein 14 protein. Length = 152 Score = 189 bits (461), Expect = 1e-48 Identities = 95/141 (67%), Positives = 105/141 (74%), Gaps = 1/141 (0%) Frame = +3 Query: 63 MAP-RKNKVAKEEVQVTLGPQHLVGETVFGVAHIFASFNDTFVHVTDLSGRETIARVTGG 239 MAP RK K +E+ V+LGPQ GE +FGVAHIFASFNDTFVH+TD+SGRETI RVTGG Sbjct: 1 MAPARKGKAKEEQAVVSLGPQAKEGELIFGVAHIFASFNDTFVHITDISGRETIVRVTGG 60 Query: 240 MKVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKLRAXXXXXXXXXXXXAQXXXXXX 419 MKVKADRDE+SPYAAMLAAQDVA++CK LGI ALHIKLRA AQ Sbjct: 61 MKVKADRDESSPYAAMLAAQDVADRCKQLGINALHIKLRATGGTRTKTPGPGAQSALRAL 120 Query: 420 XXXXMKIGRIEDVTPVPSDST 482 MKIGRIEDVTP+PSD T Sbjct: 121 ARAGMKIGRIEDVTPIPSDCT 141 >Z49911-5|CAA90128.1| 431|Caenorhabditis elegans Hypothetical protein M28.6 protein. Length = 431 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +3 Query: 117 PQHLVGETVFGVAHIFASFNDTFVHVTDLSGRETIARVTGGMK 245 P H G T FG H + + + +TDL R TIA VT G+K Sbjct: 365 PIHRAG-TQFGFGH---TGHGCQMVITDLKNRVTIAYVTNGLK 403 >AC024785-5|AAF60596.1| 577|Caenorhabditis elegans C-type lectin protein 73 protein. Length = 577 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +2 Query: 302 CSREMQNSWHNGLAHKAPCYWWKQNKDPWSWCSVCTSGSC-SFKYED 439 C+R+ W N +A WWK+N + S T C SF + D Sbjct: 492 CTRDKIFEWMNNVATDFRSEWWKKNNNLHSPNPSGTGQRCLSFAFGD 538 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,976,870 Number of Sequences: 27780 Number of extensions: 281706 Number of successful extensions: 761 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1176726318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -