BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11l15 (640 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0147 + 12763526-12763815,12763938-12764067,12764185-127644... 30 1.3 01_01_0558 + 4098383-4098510,4100462-4100572,4100765-4100853,410... 28 5.4 04_03_0094 - 11113279-11114469 27 9.5 >09_03_0147 + 12763526-12763815,12763938-12764067,12764185-12764435, 12764546-12764750,12764878-12764918,12765006-12765131, 12765429-12765502,12765671-12765891,12766251-12766345, 12766463-12766679,12766781-12766906,12766988-12767086, 12767171-12767380,12767496-12767606 Length = 731 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = +3 Query: 183 GHHIVFVASVLWMQGPQMTLQPLENECGILLYNGDIFDESWDSRTSDTQIIM 338 G + + ++ WM GP + L N + LYNG + + D ++ M Sbjct: 401 GDVVAWPTNLGWMMGPWLVYASLLNGASMALYNGSLNSSGFAKFVQDAKVTM 452 >01_01_0558 + 4098383-4098510,4100462-4100572,4100765-4100853, 4100974-4101107,4101337-4101435,4102619-4102994, 4103883-4104337,4104419-4107409 Length = 1460 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -2 Query: 276 TKGCHIHFREVVMSFADLASIELRLRKLCGVQ 181 T G IH R + + F+D+A + +RKLC +Q Sbjct: 814 TIGDLIHLRYLDLRFSDIAELPESVRKLCHLQ 845 >04_03_0094 - 11113279-11114469 Length = 396 Score = 27.5 bits (58), Expect = 9.5 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 71 FGVKLRKM*HSERY*CPSKTQKQRTRSLTEEGFY-F*NWTPHSFR 202 F VKLR HS R CP T + + EE + F PH FR Sbjct: 116 FDVKLRYWDHSRRNLCPFGTHPKASADFDEEMRHSFTATPPHIFR 160 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,660,455 Number of Sequences: 37544 Number of extensions: 289876 Number of successful extensions: 701 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -