BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11l14 (666 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.0 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.5 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 6.0 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 8.0 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 8.0 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 85 SVSDTPSLKDLPKVATDLKS 144 SVS PS+K + K ATD S Sbjct: 156 SVSCVPSVKHVAKCATDFSS 175 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 583 CFCTMATLPGQWRRTATPDFIQIL 654 C C+M LPG +T+T ++ +I+ Sbjct: 684 CNCSMDWLPGINNQTSTREYPRIM 707 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 316 GSSPESRCASAGSNQTSRYRRIKTSGSSQWRRLQ 215 GSS + + S+ T + K SS WR+L+ Sbjct: 190 GSSGDDLSSEWDSDYTDKSNEKKIPKSSGWRKLR 223 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = +1 Query: 133 DLKSQLEGFNTSCLRDVDTNEKIV 204 +LKS L + C++++ T ++I+ Sbjct: 21 ELKSGLHTVQSVCMKEIGTAQQII 44 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -2 Query: 92 LTEQAIVNQYIFDEEGDRRFVHSATLSDC 6 LTE IV + D +GD + + DC Sbjct: 299 LTEAIIVQAELMDLKGDLEGLVEGVIIDC 327 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,979 Number of Sequences: 438 Number of extensions: 4007 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -