BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11l08 (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 9.0 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 9.0 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 9.0 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 304 EVLGFFFLFITRTGL 260 E L FF+ F+TR+GL Sbjct: 198 ESLCFFYSFVTRSGL 212 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 304 EVLGFFFLFITRTGL 260 E L FF+ F+TR+GL Sbjct: 198 ESLCFFYSFVTRSGL 212 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +1 Query: 517 NYSKFSTIVARPKNGAVPPNYHSTEENKYGQ*YHS*LPRMVQG 645 N S++ST + PK+ P +N+ +H+ + +V+G Sbjct: 1616 NTSQYSTFIHEPKHHQEDPPVLKYIKNQVRDVFHAPIASLVKG 1658 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 724,945 Number of Sequences: 2352 Number of extensions: 14364 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -