BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11l03 (419 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1451 + 33695734-33695806,33695946-33696179,33696341-336964... 29 1.5 >04_04_1451 + 33695734-33695806,33695946-33696179,33696341-33696434, 33696532-33696749,33696859-33696992,33697098-33697325, 33697417-33697845 Length = 469 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +2 Query: 245 GLLGTFWKCARIGERKSPYVAVCCILMAFSILFLT*NCYK 364 G+L W A++G P VC + + FL +CY+ Sbjct: 42 GVLALSWSVAQLGWVAGPIAMVCFAFVTYISAFLLSHCYR 81 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,848,571 Number of Sequences: 37544 Number of extensions: 154740 Number of successful extensions: 243 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 243 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 766563072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -