BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11l03 (419 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 1.1 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 1.1 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 1.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 3.2 DQ494417-1|ABF55368.1| 42|Apis mellifera telomerase reverse tr... 21 5.6 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 20 9.9 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 20 9.9 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 20 9.9 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 20 9.9 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 20 9.9 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 20 9.9 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 20 9.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 20 9.9 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 20 9.9 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 20 9.9 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 20 9.9 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 20 9.9 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 20 9.9 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 20 9.9 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 20 9.9 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 244 WFTGNILEMCKNW*TQIPLCCSLLYIN 324 W G + +CK W T LCC+ +N Sbjct: 102 WIFG--IHLCKLWLTCDVLCCTASILN 126 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 244 WFTGNILEMCKNW*TQIPLCCSLLYIN 324 W G + +CK W T LCC+ +N Sbjct: 102 WIFG--IHLCKLWLTCDVLCCTASILN 126 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 244 WFTGNILEMCKNW*TQIPLCCSLLYIN 324 W G + +CK W T LCC+ +N Sbjct: 102 WIFG--IHLCKLWLTCDVLCCTASILN 126 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 3.2 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 264 GNVQELVNANPPMLQSVVY*WPFQYCSSHKI 356 G++ +L NP + +SV+Y SH++ Sbjct: 669 GSLGKLTETNPKLARSVLYKIYLNTMESHEV 699 >DQ494417-1|ABF55368.1| 42|Apis mellifera telomerase reverse transcriptase protein. Length = 42 Score = 21.0 bits (42), Expect = 5.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 333 QYCSSHKIVTKCGLKC**FI 392 QYC HKI+ K KC FI Sbjct: 20 QYCLHHKILIKKN-KCNAFI 38 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 91 PVPVYYGNFPPRPIMVRPWV 110 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 91 PVPVYYGNFPPRPIMVRPWV 110 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 91 PVPVYYGNFPPRPIMVRPWV 110 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 91 PVPVYYGNFPPRPIMVRPWV 110 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 91 PVPVYYGNFPPRPIMVRPWV 110 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 91 PVPVYYGNFPPRPIMVRPWV 110 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 91 PVPVYYGNFPPRPIMVRPWV 110 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 340 PVPVYYGNFPPRPIMVRPWV 359 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 340 PVPVYYGNFPPRPIMVRPWV 359 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 340 PVPVYYGNFPPRPIMVRPWV 359 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 340 PVPVYYGNFPPRPIMVRPWV 359 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 340 PVPVYYGNFPPRPIMVRPWV 359 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 340 PVPVYYGNFPPRPIMVRPWV 359 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 324 PVPVYYGNFPPRPIMVRPWV 343 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/20 (25%), Positives = 12/20 (60%) Frame = -3 Query: 282 PILAHFQNVPSKPVLFRSMI 223 P+ ++ N P +P++ R + Sbjct: 340 PVPVYYGNFPPRPIMVRPWV 359 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,516 Number of Sequences: 438 Number of extensions: 2141 Number of successful extensions: 20 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10750329 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -