BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11k22 (210 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1313 - 26065192-26065491,26065603-26065857,26067611-260677... 26 3.6 04_03_0260 - 13580396-13582990 25 6.3 >08_02_1313 - 26065192-26065491,26065603-26065857,26067611-26067718, 26068637-26068738 Length = 254 Score = 26.2 bits (55), Expect = 3.6 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 174 KNHLYFQFWNANSYLNVYRIVIIHIIT*SVGIS 76 K+H Y +WNA + Y I+I+ I+ G+S Sbjct: 165 KDHKYRIYWNAYHHSVGYTIIILGIVNIFKGMS 197 >04_03_0260 - 13580396-13582990 Length = 864 Score = 25.4 bits (53), Expect = 6.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 192 ENILRDKNHLYFQFWNANSYLNV 124 E ++R +N L + F+NANS ++V Sbjct: 822 EGVMRVENCLDYSFFNANSVISV 844 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,576,815 Number of Sequences: 37544 Number of extensions: 65296 Number of successful extensions: 124 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 14,793,348 effective HSP length: 49 effective length of database: 12,953,692 effective search space used: 259073840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -