BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11k20 (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.1 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.1 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.8 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.8 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 2.8 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 23 2.8 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 2.8 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 467 NVQELLR-CIRSQMDSLLAGLPKKEMTAMALGLAHSLSRYKLKFSP 601 N ++LR CI+ ++ L+ K ++ L + S YKL++ P Sbjct: 49 NTSDVLRVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEP 94 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 467 NVQELLR-CIRSQMDSLLAGLPKKEMTAMALGLAHSLSRYKLKFSP 601 N ++LR CI+ ++ L+ K ++ L + S YKL++ P Sbjct: 49 NTSDVLRVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEP 94 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 2.8 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -1 Query: 152 SRIEPTYWKHTYTTIQQI 99 ++++PTY+ HTY + + Sbjct: 33 TKLQPTYFHHTYIIYESL 50 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.0 bits (47), Expect = 2.8 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -1 Query: 152 SRIEPTYWKHTYTTIQQI 99 ++++PTY+ HTY + + Sbjct: 33 TKLQPTYFHHTYIIYESL 50 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 606 LSGENFNLYLERE*ARPKAIAVISFLGSPARRL 508 +SG N + + E + KA V +F+G P R + Sbjct: 234 ISGTALNCWTQTENSLEKAKQVGAFMGCPTRNV 266 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 606 LSGENFNLYLERE*ARPKAIAVISFLGSPARRL 508 +SG N + + E + KA V +F+G P R + Sbjct: 105 ISGTALNCWTQTENSLEKAKQVGAFMGCPTRNV 137 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 606 LSGENFNLYLERE*ARPKAIAVISFLGSPARRL 508 +SG N + + E + KA V +F+G P R + Sbjct: 234 ISGTALNCWTQTENSLEKAKQVGAFMGCPTRNV 266 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,772 Number of Sequences: 438 Number of extensions: 3248 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -