BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11k18 (705 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g65490.1 68418.m08236 expressed protein similar to unknown pr... 37 0.011 At5g18420.1 68418.m02168 expressed protein non-consensus GC dono... 31 0.98 At1g02580.1 68414.m00209 maternal embryogenesis control protein ... 30 1.7 At5g07940.1 68418.m00920 expressed protein 29 2.3 At1g08550.1 68414.m00948 violaxanthin de-epoxidase precursor, pu... 29 2.3 At5g28960.1 68418.m03583 hypothetical protein 29 4.0 At5g18420.3 68418.m02170 expressed protein non-consensus GC dono... 29 4.0 At5g18420.2 68418.m02169 expressed protein non-consensus GC dono... 29 4.0 At3g02200.2 68416.m00199 proteasome family protein contains Pfam... 29 4.0 At3g02200.1 68416.m00198 proteasome family protein contains Pfam... 29 4.0 At4g21323.1 68417.m03080 subtilase family protein contains simil... 28 5.2 At3g31930.1 68416.m04041 hypothetical protein 28 5.2 At2g35800.1 68415.m04396 mitochondrial substrate carrier family ... 28 6.9 At1g55860.1 68414.m06406 ubiquitin-protein ligase 1 (UPL1) nearl... 28 6.9 At1g12260.1 68414.m01418 no apical meristem (NAM) family protein... 28 6.9 At4g27280.1 68417.m03915 calcium-binding EF hand family protein ... 27 9.2 At3g61960.1 68416.m06959 protein kinase family protein contains ... 27 9.2 At3g58340.1 68416.m06503 meprin and TRAF homology domain-contain... 27 9.2 >At5g65490.1 68418.m08236 expressed protein similar to unknown protein (dbj BAA75199.1) Length = 643 Score = 37.1 bits (82), Expect = 0.011 Identities = 35/164 (21%), Positives = 73/164 (44%), Gaps = 8/164 (4%) Frame = +3 Query: 192 EEDWKPVDL---DEDRTEEDNEPAMTTMLSALDLKKTTFDSAQLLKKVRRKVARQLSDKS 362 E+D+K ++ D D D E + ++L K+ F +++ +K + K ++ S Sbjct: 392 EDDFKGQEVPASDNDSWLYDGEDELNSVLQERQ-KEMEFYNSKKERKNKGKEKQEAGSSS 450 Query: 363 IIDYNDFIRNLQNNEANDQQFF-----FVNGQIISAVSIEEICREIDDIFKSIDRLASAT 527 + N+F +L + + QQF + ++ +E+ ++D K I+ + + Sbjct: 451 DANMNNF--DLGDISKSMQQFMHKVSSYKGAEVPENRDFKEVSIDVDRFMKDIESMLGSQ 508 Query: 528 STLRNRKPDVVQCSISAGDLSFDDTIDQIDEEKIDQCIEEAFEE 659 D S+ D+ FDD D + E+ ++ +E+FEE Sbjct: 509 GRDEQADDDSDGSEGSSMDMDFDDVEDDSEGEESNEDAKESFEE 552 >At5g18420.1 68418.m02168 expressed protein non-consensus GC donor splice site at exon 1, unknown (C40) protein, Homo sapiens, EMBL:AF103798 Length = 441 Score = 30.7 bits (66), Expect = 0.98 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +1 Query: 292 LHLILRSC*KKCEEKSRDSYLINRLSTIMILYAISRITRRTIN 420 + + + +C CE +D Y+ NRL ++ ++ S I + IN Sbjct: 366 IRMYITNCISSCENAKQDKYMQNRLVRLVCVFLQSLIRNKIIN 408 >At1g02580.1 68414.m00209 maternal embryogenesis control protein / MEDEA (MEA) nearly identical to MEDEA GB:AAC39446 GI:3089625 from [Arabidopsis thaliana]; contains Pfam profile PF00856: SET domain Length = 689 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +3 Query: 273 ALDLKKTTFDSAQLLKKVRRKVARQLSDKS-IIDYNDFIRNLQNNEANDQQFF 428 +LDL KTT Q+ KKV RK +R + KS + Y + L+ + + +F+ Sbjct: 392 SLDLNKTTQRHNQVTKKVSRKSSRSVRKKSRLRKYARYPPALKKTTSGEAKFY 444 >At5g07940.1 68418.m00920 expressed protein Length = 1526 Score = 29.5 bits (63), Expect = 2.3 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 10/96 (10%) Frame = +3 Query: 183 MKLEEDWKPVDLDEDRTEEDNEPAMTTMLSALDLKKTTFDSAQLLKK---VRR----KVA 341 M+LE PV+ D ++ + ++ ML L ++ TF+ QLLK+ V++ ++ Sbjct: 148 MRLEMGESPVNYDFFGGQQQSNTQLSGMLQPLPRQQMTFNDMQLLKQQVMVKQMHEYQMQ 207 Query: 342 RQLSDKSI--IDYNDFIRNLQNNE-ANDQQFFFVNG 440 +QL + + N RN N A+D Q +NG Sbjct: 208 QQLQKQQLEARQLNSLNRNAVNGSCASDTQSRMING 243 >At1g08550.1 68414.m00948 violaxanthin de-epoxidase precursor, putative (AVDE1) similar to EST gb|N37612 Length = 462 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 540 NRKPDVVQCSISAGDLSFDDTIDQIDE 620 N +PD +C I GDL + +D+ +E Sbjct: 151 NNRPDETECQIKCGDLFENSVVDEFNE 177 >At5g28960.1 68418.m03583 hypothetical protein Length = 457 Score = 28.7 bits (61), Expect = 4.0 Identities = 26/86 (30%), Positives = 43/86 (50%) Frame = +3 Query: 117 VNVRMGTKLLDLETILLRNEQWMKLEEDWKPVDLDEDRTEEDNEPAMTTMLSALDLKKTT 296 V+VRMG K ++ L E++M L D +DR E N+ ++T + + K Sbjct: 322 VHVRMGDKACEMRVAAL--EEYMHL------ADRIKDRFPELNKIWLSTEMKEVVDKSKD 373 Query: 297 FDSAQLLKKVRRKVARQLSDKSIIDY 374 +D + +VARQ+ +KSI +Y Sbjct: 374 YDHWRFYYT---EVARQVGNKSIAEY 396 >At5g18420.3 68418.m02170 expressed protein non-consensus GC donor splice site at exon 1, unknown (C40) protein, Homo sapiens, EMBL:AF103798 Length = 439 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 292 LHLILRSC*KKCEE-KSRDSYLINRLSTIMILYAISRITRRTIN 420 + + + +C CE K +D Y+ NRL ++ ++ S I + IN Sbjct: 363 IRMYITNCISSCENAKQQDKYMQNRLVRLVCVFLQSLIRNKIIN 406 >At5g18420.2 68418.m02169 expressed protein non-consensus GC donor splice site at exon 1, unknown (C40) protein, Homo sapiens, EMBL:AF103798 Length = 442 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 292 LHLILRSC*KKCEE-KSRDSYLINRLSTIMILYAISRITRRTIN 420 + + + +C CE K +D Y+ NRL ++ ++ S I + IN Sbjct: 366 IRMYITNCISSCENAKQQDKYMQNRLVRLVCVFLQSLIRNKIIN 409 >At3g02200.2 68416.m00199 proteasome family protein contains Pfam domain, PF01399: PCI domain Length = 417 Score = 28.7 bits (61), Expect = 4.0 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +3 Query: 231 TEEDNEPAMTTMLSALDLKKTTFDSAQLLKKVRRKVARQLSDKSIIDYNDFIRNLQNNEA 410 +E+D E T + S + K+ +++K + KVA+Q SDK+ + + NL N Sbjct: 72 SEKDLECTYTIICSIVKNAKSPEQVLEMVKAIASKVAQQPSDKASLRLK-ILFNLYNLVD 130 Query: 411 NDQQFFFVNGQIISAVSIEEICREIDDIFKSID 509 + F V + ++ ++ I FK ID Sbjct: 131 HPYARFQVYMKALTLAVDGKVTEYIVSSFKKID 163 >At3g02200.1 68416.m00198 proteasome family protein contains Pfam domain, PF01399: PCI domain Length = 364 Score = 28.7 bits (61), Expect = 4.0 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +3 Query: 231 TEEDNEPAMTTMLSALDLKKTTFDSAQLLKKVRRKVARQLSDKSIIDYNDFIRNLQNNEA 410 +E+D E T + S + K+ +++K + KVA+Q SDK+ + + NL N Sbjct: 72 SEKDLECTYTIICSIVKNAKSPEQVLEMVKAIASKVAQQPSDKASLRLK-ILFNLYNLVD 130 Query: 411 NDQQFFFVNGQIISAVSIEEICREIDDIFKSID 509 + F V + ++ ++ I FK ID Sbjct: 131 HPYARFQVYMKALTLAVDGKVTEYIVSSFKKID 163 >At4g21323.1 68417.m03080 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 from [Oryza sativa] Length = 803 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 Query: 501 SIDRLASATSTLRNRKPDVVQCSISAGDLSFDDTIDQIDEEKIDQ 635 ++DR S TL N K + Q + ++SF D I D +DQ Sbjct: 399 TLDRSFSTLITLENNKTYLGQSLYTGPEISFTDVICTGDHSNVDQ 443 >At3g31930.1 68416.m04041 hypothetical protein Length = 164 Score = 28.3 bits (60), Expect = 5.2 Identities = 19/79 (24%), Positives = 34/79 (43%) Frame = +3 Query: 192 EEDWKPVDLDEDRTEEDNEPAMTTMLSALDLKKTTFDSAQLLKKVRRKVARQLSDKSIID 371 ++ W +D+ +D E A LD K+ + LK ++ + +D+ I + Sbjct: 84 DDVWPGIDIVMIEDADDLERASNRSHLILDTKRCSNSKKICLKPIKLEKLNGKNDEEIGN 143 Query: 372 YNDFIRNLQNNEANDQQFF 428 D + NNEAN+ F Sbjct: 144 KEDEEKTGVNNEANENTNF 162 >At2g35800.1 68415.m04396 mitochondrial substrate carrier family protein contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 823 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = +3 Query: 489 DIFKSI--DRLASATSTLRNRKPDVVQCSISAGDLSFDDTIDQIDEEKIDQCIEEAFEEL 662 D+ KS LASA ST D ++ + A LSF + I ++ E + + + Sbjct: 540 DVLKSALAGGLASALSTSLMHPIDTIKTRVQASTLSFPEVIAKLPEIGVRGVYRGSIPAI 599 Query: 663 SGSFTS 680 G F+S Sbjct: 600 LGQFSS 605 >At1g55860.1 68414.m06406 ubiquitin-protein ligase 1 (UPL1) nearly identical to ubiquitin-protein ligase 1 [Arabidopsis thaliana] GI:7108521; E3, HECT-domain protein family; similar to GI:7108521, GB:AAF36454 from [Arabidopsis thaliana] Length = 3891 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 186 KLEEDWKPVDLDEDRTEEDNEPAMTTMLSALDLKKTTFD 302 KLE+ KPVD+ ++ E EP + +++A LK D Sbjct: 1586 KLEDTEKPVDVPQEEA-EPKEPPVDEVIAASQLKLVQLD 1623 >At1g12260.1 68414.m01418 no apical meristem (NAM) family protein similar to NAC2 (GI:6456751) [Arabidopsis thaliana]; contains Pfam PF02365 : No apical meristem (NAM) protein Length = 395 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/75 (25%), Positives = 35/75 (46%) Frame = +3 Query: 465 EEICREIDDIFKSIDRLASATSTLRNRKPDVVQCSISAGDLSFDDTIDQIDEEKIDQCIE 644 E++ ++ D ++ +D+ + S L N + SI + Q+DEEK + Sbjct: 319 EQVMDQVTD-WRVLDKFVA--SQLSNEEAATASASIQNNAKDTSNAEYQVDEEKDPKRAS 375 Query: 645 EAFEELSGSFTSVCQ 689 + EE + S +S CQ Sbjct: 376 DMGEEYTASTSSSCQ 390 >At4g27280.1 68417.m03915 calcium-binding EF hand family protein similar to EF-hand Ca2+-binding protein CCD1 [Triticum aestivum] GI:9255753; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 130 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +3 Query: 495 FKSIDRLASATSTLRNRKPDVVQCSISAGDLSFDDTIDQID 617 F+S+ R A+A L + + V+C I GD D ++Q++ Sbjct: 56 FESLRRNAAAVLGLGDLTDEDVRCMIKEGDFDCDGALNQME 96 >At3g61960.1 68416.m06959 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 626 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +3 Query: 270 SALDLKKTTFDSAQLLKKVRRKVARQLSDKSIIDYNDFIRNLQNNEANDQQF 425 S L++ D L KVR + +++S S ID+ + IR + E D+ F Sbjct: 32 SGLEVAVKEIDKKLLSPKVRDNLLKEISILSTIDHPNIIRFYEAIETGDRIF 83 >At3g58340.1 68416.m06503 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 325 Score = 27.5 bits (58), Expect = 9.2 Identities = 20/72 (27%), Positives = 34/72 (47%) Frame = +3 Query: 264 MLSALDLKKTTFDSAQLLKKVRRKVARQLSDKSIIDYNDFIRNLQNNEANDQQFFFVNGQ 443 ++ LD + S+ L+ K + +VA+Q+ K II ND I Q ++ VNG Sbjct: 136 VIGTLDESEEIIKSSDLINKTQ-EVAQQV--KEIIQPNDLINKTQEVAQQVKESIDVNGF 192 Query: 444 IISAVSIEEICR 479 + +E + R Sbjct: 193 QVLPSQVESVRR 204 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,492,532 Number of Sequences: 28952 Number of extensions: 222904 Number of successful extensions: 835 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -