BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11k12 (683 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 3.1 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 4.1 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 9.4 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.6 bits (46), Expect = 3.1 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 575 RCHQCHDKLRLSHRISNHLHIDLSHVKHN 661 RC++ ++ L+ R S+ L +S KHN Sbjct: 703 RCYKMQEQFTLNFRNSDELIKFISIAKHN 731 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 4.1 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +1 Query: 109 VYNMLMDLTDELELSDSGMESLT-TSKDDT 195 +Y+ L+DLTD EL G + + T DT Sbjct: 352 IYSDLLDLTDNNELFHLGSDEVNLTCWQDT 381 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 9.4 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = +3 Query: 447 FIGNIVCSCHI 479 + N+VC CH+ Sbjct: 918 YTANVVCICHV 928 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,584 Number of Sequences: 336 Number of extensions: 3446 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -