BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11k04 (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 25 2.5 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 24 4.3 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/37 (27%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 328 WKKIANDPELEGKWSIGSVRTNVREDRR-GILSEARR 435 W+K++ D EGKW +++ ++ ++ L E R Sbjct: 15 WRKVSPDDSAEGKWGEKVIKSLAKKMKKSSALEELER 51 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 24.2 bits (50), Expect = 4.3 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 538 KRNKSPKHGYLSAKTPKSLMSAENTPKKKYKRNN 639 KR+ + + +TPKS PKKK K+ + Sbjct: 133 KRDNNARQRSAQRETPKSSGGQSKQPKKKKKKRS 166 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 687,287 Number of Sequences: 2352 Number of extensions: 13388 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -