BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11k03 (730 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 3.2 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 5.5 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 3.2 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -2 Query: 258 WYLLIDYLLVFFTFTNRLNDHL*AAILLSNIVSLVRYVH 142 W L +DY+ V + L DH A + +N + L RY H Sbjct: 462 WSLPLDYISVERKNSAFLQDHDYAVLKNNNRIILKRYPH 500 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.8 bits (49), Expect = 5.5 Identities = 10/38 (26%), Positives = 22/38 (57%) Frame = -1 Query: 649 IEEPCGKLVSFSIEEFLNEIANSGCSCLYKHCLNIGWN 536 ++ CGKLVSF + + + + L+ + +++G+N Sbjct: 579 MKRKCGKLVSFDLSQAFDRVDR---GFLFNNMVSMGFN 613 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,746 Number of Sequences: 2352 Number of extensions: 12318 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -