BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11k02 (735 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.3 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 3.9 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.9 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 9.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.1 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 9.1 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 477 KTMLTRWEEDGLSVLRKNN 533 KT L++W +DG +V +K N Sbjct: 226 KTKLSQWRKDGGTVKKKVN 244 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 3.9 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 3 PQFADVASLTFTVTFVSIIV*FSSINYNF 89 P A TF + VSI+V IN+NF Sbjct: 294 PLIAKYLLFTFIMNTVSILVTVIIINWNF 322 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 3.9 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -3 Query: 370 VECSQLNKILLPCFVSVIVVKPETPLVL*RVLDQK 266 VE + N C S I+V PET L +DQK Sbjct: 1230 VEMPRSNADYEVCIGSQIMVSPETLLSYDEKMDQK 1264 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 666 VQIAILSTFGLTLTTAPQISS 604 V ++ L TFG TL AP++ + Sbjct: 7 VLLSSLVTFGWTLEDAPRVKT 27 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 609 SSEFSKFSPIKRRTT 565 SSEFSK S + R T+ Sbjct: 3 SSEFSKISKVDRSTS 17 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 666 VQIAILSTFGLTLTTAPQISS 604 V ++ L TFG TL AP++ + Sbjct: 7 VLLSSLVTFGWTLEDAPRVKT 27 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,964 Number of Sequences: 438 Number of extensions: 4264 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -