BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11j23 (608 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50623| Best HMM Match : NAD_Gly3P_dh_C (HMM E-Value=0) 120 7e-28 SB_49139| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 8e-22 SB_38574| Best HMM Match : WW (HMM E-Value=4.9) 28 6.8 SB_22742| Best HMM Match : ubiquitin (HMM E-Value=0.01) 27 9.0 SB_47883| Best HMM Match : F5_F8_type_C (HMM E-Value=1.4e-14) 27 9.0 >SB_50623| Best HMM Match : NAD_Gly3P_dh_C (HMM E-Value=0) Length = 358 Score = 120 bits (290), Expect = 7e-28 Identities = 55/98 (56%), Positives = 73/98 (74%), Gaps = 1/98 (1%) Frame = +2 Query: 146 KQPKNKVCIVGSGNWGSAIAKIVGRNAASLSN-FEDRVTMWVYEEIIEGKKLTEIINETH 322 ++ + +V I+GSGNWGS IA+IVG+N ++ F + V M+ YEE+++G KLTEIIN H Sbjct: 3 EEGRKRVAIIGSGNWGSVIARIVGQNVKEHNDVFFEGVEMYTYEELVDGVKLTEIINTKH 62 Query: 323 ENVKYLPGHKLPSNVVAVPDVVEAAKDADLLIFVVPHQ 436 NVKYLP +P N+ A PDVVE KDAD+L+FVVPHQ Sbjct: 63 MNVKYLPDFLIPENIHANPDVVECVKDADILVFVVPHQ 100 >SB_49139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 772 Score = 100 bits (240), Expect = 8e-22 Identities = 61/151 (40%), Positives = 88/151 (58%), Gaps = 2/151 (1%) Frame = +2 Query: 161 KVCIVGSGNWGSAIAKIVGRNAASLSN-FEDRVTMWVYEEIIEGKKLTEIINETHENVKY 337 KV ++GSGNWG+AIA+I+G N + F ++V M+VY+ +I G+KL+EIIN HENVK Sbjct: 229 KVTVLGSGNWGTAIARIIGDNVRKKPHLFHNKVQMYVYDSLINGRKLSEIINTEHENVKD 288 Query: 338 LPGHKLPSNVVAVPDVVEAAKDADLLIFVVPHQFVRTICSTLLGKIKPTAAALSLIKGFD 517 LPG K+P NV F+ ++C + IKP A+SLIKG D Sbjct: 289 LPGFKIPPNV-----------------------FLDSVCQKIKSSIKPDVLAISLIKGLD 325 Query: 518 IAEGGGIDLISHIITRCLKIP-CAVLMGANI 607 + G+ L+S+ I L + +V+MGAN+ Sbjct: 326 HRK-KGLHLVSNQIKESLGLQHVSVMMGANL 355 >SB_38574| Best HMM Match : WW (HMM E-Value=4.9) Length = 256 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 431 HQFVRTICSTLLGKIKPTAAALSLIKGFDIAEGGGIDLIS 550 H+ C + +IKP +IKGF I G +L S Sbjct: 191 HERRNIACQRFVSRIKPENPLFPIIKGFHITHDSGYNLRS 230 >SB_22742| Best HMM Match : ubiquitin (HMM E-Value=0.01) Length = 792 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 125 NILDMADKQPKNKVCIVGSGNWGSAIAKIV 214 +++DMAD+ K C+ SGN + I I+ Sbjct: 348 DLIDMADRYNKTPFCLAKSGNADNTIISIL 377 >SB_47883| Best HMM Match : F5_F8_type_C (HMM E-Value=1.4e-14) Length = 265 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -2 Query: 514 KSLNQRQSSCSWLYFSKQSRADSSDKLMRHHKY*KISIFCSFNYIWNSN 368 KS N C W Y ++ R + + R H+ KI IF N++W N Sbjct: 217 KSHNYTIFLCLWGY-ARGLRPRLAPLIYRRHQNRKIFIFHEGNFVWQPN 264 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,126,235 Number of Sequences: 59808 Number of extensions: 287218 Number of successful extensions: 681 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -